KEGG   Candida albicans: CaO19.5253Help
Entry
CaO19.5253        CDS       T00189                                 

Definition
likely protein kinase similar to a wide range of putative dual specificity kinases; weaker similarity to S. cerevisiae YAK1 (YJL141C)
Orthology
K18670  
dual specificity protein kinase YAK1 [EC:2.7.12.1]
Organism
cal  Candida albicans
Brite
Enzymes [BR:cal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     CaO19.5253
Protein kinases [BR:cal01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   CaO19.5253
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 732 aa AA seqDB search
MNHDNIALFESEFSQIHLNHRNNLDKKISPTRRKKVLYPPHLYPARLDAGRQISKELSPA
SVANLNSNKYDMSRTPVTPKRTTSATNSDTQNKLTNLQSSKNPFRSDRTVSYPVPDKISK
KSDGQFSFMRETSSSLQKKQVLTPVNERRTTSGRSSSVGSSSTKKRLEYSRQLSQRSKRH
ISNSLINKSNHDFSDFENSHTGKYRSSSESSPEEYYQLNTDDIVIDESPSKPRRRMTQPL
PKTDNVFDRLYPKSLKHPTAKSPTTKPNKETQTSKSIPRSKIESISQLHQSLYIKNPQLF
RDDTLEEQLQAPHDIQESDLDGLSMYEKGELARKKEIYYISKRPLRQIAVNSQENNFGFD
DNKGNYIIIPEDHINYRYEIISVLGTGSFGNVVMANDHKTNRLVAVKIINNHINWSLQQS
INEIKLLKNLQDRQKTLQNSNIISILDNFNFRSHMCIITELLSTNLYSMLELTNFQGFGY
DLLRYITKQILTGLQFIHDANIIHCDIKPENIMIKLPPSPNHNWFQIKIIDFGSSCFVNE
TSFTYIQSRYYRAPEVLLGTSYDQKIDIWSLGCLVVELFTGVPLLPGKNEYDQLGLIVEL
FGVPKPQTILKLRNKLTKKTNQVSIASNDTVVPLPSISDKNLKRTLIYKIFDHNGKINLT
ALSQYYNDSNAASVNKLFKIGSKTLEGQIGLHRFNLKPEEKERFLEFLLYIFVWDPSERR
NTHDLLNTSFLE
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgaatcatgacaacatagcactatttgaaagtgaattttcacaaatacaccttaatcat
cgtaacaatcttgacaaaaaaatctcaccaactcgaaggaaaaaagtgttatatccacca
catctatacccggcgagacttgacgctggtagacaaatatcaaaagagttatcacctgct
tccgtggctaatttgaattcaaacaaatatgacatgtcgaggactccagttacgccaaag
agaacaacaagtgcaactaatagcgacactcaaaacaaactaaccaacttgcagagctcc
aaaaatccattccggtcagacagaacagtgagttatccagttccagataaaatatctaaa
aaatcagatggccagttttcatttatgagagagacatcatcatcattacaaaagaaacaa
gtattgactcctgttaacgaaaggcgtaccaccagtggtagatcgtcatccgttggtctg
tcctcaacgaagaaacgcttagagtattctagacaattatcacaaagatccaagagacac
atctccaacagtctaatcaataaatcaaaccacgactttagtgattttgagaattcacac
acaggcaagtaccgactgagtctggaatcatcacccgaagaatattaccaactaaacact
gatgatatcgtcattgatgagtcaccttccaaaccaagaagacgcatgacccaacctcta
ccaaagaccgataacgtatttgatagattgtatcctaaatcattaaagcatccgactgca
aaactgccaacaacaaaaccgaacaaagaaacacaaaccctgaaatctattcctcgactg
aaaatagagtctatatcacagttgcaccaatctttatacataaaaaaccctcaactattc
cgtgacgatacattggaagaacaacttcaagcacctcacgatatccaggaatctgattta
gatggtctcagtatgtacgaaaaaggtgaacttgcaaggaaaaaagagatttattacata
tcaaaacggccacttcggcaaatagcagtgaattcacaggaaaacaattttggatttgat
gataataaaggtaattatattatcattccagaagatcatatcaattatcgatacgaaatt
atatctgttcttggaacagggtcgtttgggaatgttgttatggcaaacgaccataaaaca
aacagactagtagcagtcaaaataataaacaatcacataaattggtcattacaacaatct
atcaacgaaatcaaactactcaaaaacttacaggacagacaaaagactttacagaattca
aacataatatctattttagataatttcaattttcgaagtcatatgtgtattattacagaa
ctattatcaacgaacttgtattcaatgttggagttgacaaatttccaagggtttggttat
gatttacttcggtatataacgaaacaaatacttacaggattgcaattcatacatgatgct
aacattattcattgtgatattaagccagaaaatatcatgatcaaacttccaccatctcct
aaccataattggtttcaaattaaaataatcgattttggatcttcgtgttttgtcaatgaa
accagtttcacgtatattcaatcaagatactatcgagcccctgaagtactacttggtaca
agttacgaccaaaaaatagacatatggtcattaggatgtcttgtcgttgaattgtttact
ggtgtaccgttattacctgggaaaaatgaatatgatcaacttggactaatagtggagtta
ttcggagttccaaagccacaaacaatactaaaattgaggaataaattaacgaaaaagacg
aatcaagtactgattgcttcaaacgatacagttgttcccttgccatctatactggataaa
aatttgaaaagaactttgatttataaaatatttgaccataatgggaaaataaatcttaca
gctttatcgcaatattataacgattctaatgccgcatcagttaacaaattgtttaaaatc
ggttcgaaaactttagagggtcaaattggtcttcataggtttaatttgaaacctgaagag
aaggaaagatttttagaatttttattgtatatatttgtgtgggatcccagtgaaagaaga
aacacacacgatctattaaatacgtcttttttagagtag

DBGET integrated database retrieval system