KEGG   Candida albicans: CaO19.5257Help
Entry
CaO19.5257        CDS       T00189                                 

Gene name
LCB4
Definition
similar to S. cerevisiae LCB4 (YOR171C) sphingoid long chain base (LCB) kinase
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
cal  Candida albicans
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:cal00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    CaO19.5257 (LCB4)
Enzymes [BR:cal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     CaO19.5257 (LCB4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 530 aa AA seqDB search
MSSSSSTPQATGLQMSDSIKSSTDRLLYRKNDIVSAKLSSDNGIYLSGQPLQHQPKHEES
ILDTLSACYKTPDTTESDFIPFKNILNVESIAGSVDEADEVGNSNLLEITYALPFSDLNH
DLKIDKIKVDIESGPEIPPSLAQFILTESYGKSIIRPSILVLINPHGGQGHAKTIYKNKI
LPILQAARANVTYFETKYHGHATEIARELDVNDYDIIVCCSGDGIPHEVINGFYLRPDKG
LSAFNKIAVTQLPCGSGNALSLSTHGSKNASVATLYMLKAHKTKLDLMAITQGTGSEKIT
KLSFLSQCYGIIADSDIGTEHLRWLGPIRFELGVIQKVFSGAKYPCDLFVKYKYDNNSEI
LNHVNDYLSNNDTENELPIVTEENLQITSPDLDQPVPNDWRHIPQEISHNLNILYVGKMP
FVSADTQFFPAALPNDGSMDMIVTDSNNSVWKLTSILLAVESGKHIDDEKVHHTKVLSYR
LIPNIKDDSKHYISIDGEDFPFEPFQVEILPGVLTGLLQDGNFVETSFTK
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcctcttcttctacccctcaagcaactggtttgcaaatgagtgatagtatcaaa
tcttccacagatagattgttgtaccgcaaaaatgatattgtcagtgctaagttaagctcg
gataatggtatttatttatccggacaacctttacaacatcaaccaaaacatgaagaatcg
attttggatactttaagtgcatgttataaaacccctgacacaacagaatcagatttcatt
ccatttaagaatatattgaacgtagaatcgattgcaggtagtgtcgacgaagcagatgaa
gttggcaactccaatttattagagataacctatgctttaccattcctggatttgaatcac
gacttgaagattgataaaataaaagttgatatagaaagtggcccggaaatacccccttcc
cttgctcaatttattttaacagaatcatatgggaaaagtataattcggccctctattttg
gtattgataaacccgcatggcggccaaggacacgccaaaactatttacaaaaataaaatc
ttaccaatattacaagcggctcgtgctaatgttacgtattttgaaactaaatatcatgga
cacgccactgagattgcgcgtgagctagatgtcaatgattatgatataattgtttgttgt
tctggcgatgggatacctcatgaagttatcaatggcttctatcttcgtccagataaaggt
ttactggcattcaacaaaattgcagttactcaattaccttgtgggtcagggaacgcgttg
agtttgagtacacatggtagtaaaaatgcttcagttgcaactctttatatgttgaaagct
cataagacaaaattggatttgatggctattacccaaggtacaggaagtgaaaagataacg
aaattgtcatttttaagtcagtgctacggtattattgctgattctgatattggaacagaa
catttacgttggttgggtcctatacggtttgaacttggagtgatacaaaaagtgttctcg
ggggcaaaatatccttgtgacctatttgtgaaatacaagtacgataataattcagagatt
ttgaatcatgtaaatgattacttgagtaataatgatactgaaaacgagttacccattgtc
actgaagagaacttgcaaataacgagccctgatttagatcaacctgtccccaatgattgg
agacatattcctcaagaaatttctcataatttgaacatcttgtatgttggcaaaatgcca
ttcgtgtctgcagatactcagtttttccctgctgctctaccgaacgatggttcaatggac
atgattgtcaccgattccaataactcagtgtggaaattgacatcgatattattggcagtt
gaaagtgggaaacatattgatgatgaaaaagtgcaccatacaaaagttttgagttatcgt
ttgataccaaacattaaagatgatagcaaacactacatatctattgatggcgaagatttc
ccttttgaaccttttcaagtggagattttgccaggtgtgttgacaggattactacaggat
gggaactttgtagaaacatcatttaccaaatag

DBGET integrated database retrieval system