KEGG   Candida albicans: CaO19.5367Help
Entry
CaO19.5367        CDS       T00189                                 

Gene name
RDH54
Definition
Putative helicase similar to RAD54
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
cal  Candida albicans
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:cal03440]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 796 aa AA seqDB search
MFTLFFFTTDQMNVRPNAPFRPPRPIKGGVAVVQKVVKRKLPTTTNPKPAKILTTDPGST
KYVIQWRKKTSKKNKTWDGDGYAVIKQLENGACEISIKNSDGKPMGKRVFTATPNLDDVI
SVGPYELELDEKVGSNSTSQTVTRVTHQFKKVAPPTASSRKPLYDDCADAIALPPPPKAK
DYVKVNIDPHLAKVLRPHQVEGVKFMYECLMGYRGFGGHGCLLADEMGLGKTLMTITTIW
TLLKQNPFMEKGAVVNKVLVVCPVTLISNWRQEFRKWLGANKLNVLTLNNPMSNEKQDIL
NFGKLNVYQVLVVNYEKLVAHFDELSAVKFDLLVCDEGHRLKNSANKVLNNLIKLNIPKK
IVLTGTPIQNELVEFHTLISFLNPGVLPELKLFQRNFITPISRARDINCFDPEVKKRGEE
ISQQLIELTQSFILRRTQAILANYLTQKTDILLFVPPTSLQLKLFDYITNLKKFNQFEAF
TMINLFKKICNSPSLLADDELFKKIVEEKFNLGMASGKINILVPLLLEIASLGEKIVLIS
NYTKTLDLLEQVLRKVSLTFSRLDGSTPNNVRSKLVNQFNTNPDINVFLLSSKSGGMGIN
LVGASRLILFDNDWNPATDLQSMSRIHRDGQLKPCFIYRLFTTGCIDEKIFQRQLVKNKL
SSKFLDNDATSKSDVFDNDDLKNIFEIDTSTISNTHDLLECVCEGDGSMLSQPTIEESEP
PPKQAWVTALELKKKIDDGEALKRTAVKFALNDYRHYNPEVNRNLDFDSALHRIANNSSY
ENKQLPITFIMSRVTN
NT seq 2391 nt NT seq  +upstreamnt  +downstreamnt
atgtttaccctttttttttttaccacagatcaaatgaatgttcgacctaatgctccgttt
cggcctcctagaccaataaaggggggtgttgcggtggtgcagaaagtagtaaaacgaaaa
ttgcccactaccaccaatcctaaacctgcaaagattttgactaccgatcccggctcaaca
aaatacgtgatccaatggagaaagaaaacttcaaagaagaacaaaacatgggacggtgat
gggtatgccgtgattaaacagcttgagaatggggcatgcgagatatctatcaagaactct
gatggcaaacctatggggaaaagagtgtttactgcgacacctaaccttgacgacgtgatt
agtgtgggaccctatgaattagaattagacgaaaaagtagggtctaactcaacttcccag
acagtgacacgtgttacccaccagttcaaaaaggttgctcctcccacagctagtagtcgg
aaaccgctttatgacgattgtgccgatgccattgcgttgcctcctcctccaaaagccaaa
gattatgtcaaagtaaatatcgatccacatttggcaaaagtgcttcgtccgcatcaggtt
gaaggtgtgaagtttatgtatgagtgtttaatggggtaccgtgggtttggcgggcacggg
tgtttgttagcagatgaaatggggttggggaaaacgttgatgacaatcactacaatctgg
acgttgctcaaacaaaacccgtttatggaaaaaggtgcagtggtaaataaggtattggtg
gtgtgtcctgtcacgcttatttccaattggagacaggagtttaggaaatggttaggtgct
aataagctaaacgtgttgacgctcaacaacccaatgtcaaacgagaaacaggatatactc
aattttggaaagttgaatgtgtaccaagtgttagtggtgaattatgaaaaacttgtggca
cattttgatgaactctcagcggtcaagtttgatttgttagtgtgtgacgagggccatcgt
ttgaagaatagtgcaaataaagtattgaataatcttatcaagctcaatattccgaagaaa
attgttttgacgggtacgccgattcaaaacgagttggtagagtttcacacgttgatctcg
tttctcaacccgggtgtgcttcccgagctaaaattgtttcagcgaaactttataacacct
atatctagggcccgagatatcaactgttttgaccctgaagtgaagaaacgcggtgaagag
atatcgcagcagttgattgaattgactcagagttttattcttagacgtacacaagcgatt
ttggctaattacttgacacagaaaactgacattttgttgtttgttccacctacatcgttg
cagctcaagttgttcgactatataaccaacttgaagaaatttaatcagtttgaggcattt
accatgatcaatttgtttaaaaagatttgcaattccccttcgttgttggccgacgacgag
ttatttaaaaagattgttgaagaaaagtttaatttggggatggcatccggtaaaataaac
attcttgtgccgttgctattggaaattgcttcgcttggggaaaagattgtcttaatttcc
aactacaccaagactttggacttgttggaacaggttttgcgcaaggtcagcctaacattt
tcgagattagatgggtcgacccccaacaatgtgcgtagcaagttggttaatcagtttaac
acgaaccccgacataaacgtatttttattgtcgtcgaaatctggcgggatggggatcaac
ttggtcggggcttcgaggttgattttgtttgacaatgactggaacccagcgaccgatttg
caatcgatgtcgcgaattcacagagacggacaattgaaaccgtgtttcatttataggcta
ttcaccacggggtgtattgacgagaaaatctttcagcgacagctcgtgaagaacaaattg
agttccaagtttttggacaatgacgccacgtccaaatctgatgtgtttgacaatgatgat
ttgaagaatatttttgagatagatacatcgacaatatccaatactcatgatttattagag
tgtgtgtgtgagggcgacgggtcgatgttgagtcagccaaccatagaggaaagcgaacca
cccccaaaacaagcatgggttactgcattagagcttaagaagaagattgacgatggtgag
gcgctaaagaggacggctgttaaatttgccttgaacgattatcgacactacaatccagag
gtgaaccgtaatttggattttgattctgcgctacaccgaattgctaacaattcaagctat
gaaaataagcaattgccaattacatttataatgctgagagtaactaattaa

DBGET integrated database retrieval system