KEGG   Candida albicans: CaO19.540Help
Entry
CaO19.540         CDS       T00189                                 

Gene name
PPT2
Definition
palmitoyl protein thioesterase similar to C. elegans ppt-1 (F44C4.5)
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
cal  Candida albicans
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cal00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    CaO19.540 (PPT2)
  Lipid metabolism
   00062 Fatty acid elongation
    CaO19.540 (PPT2)
Enzymes [BR:cal01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     CaO19.540 (PPT2)
Lipid biosynthesis proteins [BR:cal01004]
 Fatty acid synthase
  Component type
   CaO19.540 (PPT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
R
AA seq 316 aa AA seqDB search
MLLSNLFNVQQTILSLIPATNFDVSTSFPEPVLSTTDTYRPVVIWHGLGDNYNTSGIHKV
HEILDSMYPGIFVYAIRLDDNPSSDEQKSFFGDANKQIDEVCQQLRNITELSHGFDSIGF
SQGGVFMRGLIERCPLEVNNLITFGSPHLGVSELPLCKDRFDWLCKRRNALLKKQVWHDS
VQKRVIPAQYFRDPANIDQYLEHSNYLADINNERDEKNATYKENFSKLNKLVLVSFTEDT
TLVPKESSQFHDFDPEHKRSIPFLYTELYKNDYIGLKTLYEKNSVDFLSIEAEHMHIDED
FIKNIAQEYLGGKLCT
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgttattactgaatttattcaacgtccaacaaactatacttctgcttataccagcgaca
aattttgatgtgtccacaagtttcccagaacctgttttgtcgacaaccgatacttaccga
ccagtcgtaatttggcatggtttaggtgacaactataacacgtccggtatacataaagtc
catgaaatattagacagcatgtatccaggaatatttgtctatgcaatacgtttagatgat
aacccttcttccgatgaacaaaagtctttttttggggatgccaacaaacaaattgacgag
gtgtgccaacaacttcgaaatatcactgaattactgcatgggtttgattctattggattc
tctcaaggtggggtttttatgagaggtttgatagaaagatgccccttagaagtgaacaat
ttaataacttttggttctccgcatttgggagtgctggaactacctctatgcaaagaccgt
tttgattggttatgcaaacggagaaatgcattattgaagaagcaagtttggcacgatagt
gttcaaaagcgagttataccagcacagtattttagagatccagcaaacatagaccaatat
ttagagcattcaaattacttggcagatataaacaacgagcgcgatgaaaagaatgcaact
tacaaggaaaacttttcaaaattgaacaaattagtgttagtaagttttaccgaagatact
actcttgtgcctaaagagagttcacagtttcatgattttgacccagagcacaagagaagt
atcccctttctttatacggaattatacaagaacgactacattggattaaaaaccctttac
gaaaagaattcagttgattttctatcgatcgaagcagaacatatgcatattgatgaggat
ttcataaaaaatattgctcaagagtatttaggtgggaaattatgtacgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system