KEGG   Candida albicans: CaO19.5506Help
Entry
CaO19.5506        CDS       T00189                                 

Gene name
PLC1
Definition
phospholipase C
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
cal  Candida albicans
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1100 aa AA seqDB search
MLESLNRRNSIDSNQGDNDNDNDNHSNDELSPSELYYSPSGSPPKSQLLLRKSSSPSSYS
PIKSDLPNIYSHLRSNDSESPPQPSPKQQSSLSSSSSSSSSSNTKSSTTKNIFKKLLRIN
KSSDNIDESRSIVSNNGGSPMSDSTTVTSTLSTDTAPKRGKSIQRSQILHHTDSDSLYLE
NQIELRPEISKSIGNIKIPSIFTNDGMPLLKISHKSKKRILFWIDPSCFKFSWRMANSTT
TTTSATTSATTSGLPQGITNTTALSNSAIISTPAIATSAIHRLSITNRTTHEFALDDIKS
IYIQNEGSGYREELNISQKLEKNWITIIYFNHKKNSLKSLHLITDNDHDFKKLISAIYNL
KQLRSQLAKEFLIDLNELDENYVKMLLNKELLAGDNGNVDGNEVDIQKSHKHVREFLSFN
DILKYSKRLNINVNTNHLQQIFDQVLLLSSATTEKPVSTPLFEKGLNFEQFKQFVSILKD
RKDLQEIWDSLAQGKEVLQFDEIKNFIINIQKENFSDDDDNSTINLIFQKYCSNDNGWNK
ESLNEYLLSSYSTPYREITQTQTNYYDYPLNEYFISSSHNTYLTGRQVAGDSSVEGYIRT
LQRGCRCVEIDIWNGDSNTTTTTVIGTKDDDDKNEYEPIVNHGRTFTKPISFANVIRAIK
KFAFIVSPWPLILSLEIHCSPECQIKVVNILKDILGENMIIAPIDIDSVILPSPAELKHK
FIIKVKKTTSFQNLIETENGSFTTSTTTTTTTTTTTTTTATSLSEDNENNKSNSSSTSSF
IIRRRKNKSPKIINELSNLGIYTQGIKFRNFSLPESKTFNHCFSLGEKSINRMIKDDDKK
ISLDKHNRRYLMRVYPSGTRLKSSNFNPLPYWSHGVQMVATNWQTYDLGQQLNEALFENK
IFQGYVLKPSVLRKPTLKSSSSNVDTRTSLTTTNSKTIRFNFEIISGHQLPKFPKDDYKD
QAINPYISFEIIGAQDVQWDNNDSSPIAPTTSSSPFIRTTKIIRENGFNPNFNTKFSGSI
ITTTNDLIFIKFVVYASTSLNYPDYGENFPIAILVTKLNYLKQGYRYIYLNDLLGEQLVY
SSIFIKIEYDEDLLNEFINK
NT seq 3303 nt NT seq  +upstreamnt  +downstreamnt
atgttggaatcattaaatcgtcgaaattcaattgatagtaatcaaggtgataacgacaat
gacaatgacaaccatagtaatgatgaattaagtccatcagaattatattattcaccatct
ggtctgcctcctaaatcacaattattacttcggaaatcatcttcaccatcatcttattct
ccaattaaatctgatctacctaatatttatagtcatctacgatctaatgatagtgaatcg
ccgccacaaccatcgccgaaacaacaatcttctttatcatcatcatcatcatcatcgtca
tcttcaaatactaaatcttccacaactaagaatatttttaaaaaattattacgaattaat
aaatcatcagataatattgatgaatcaagatcaattgtactgaataatggtggttctcca
atgagtgatagtactactgtgacatcaactttgtcaactgataccgctcctaaacgaggg
aaatcaattcaacgaagtcaaattttacaccatactgattcagattctttatatttagaa
aatcaaattgaattacgtccagaaatttctaaatctattggtaatattaaaatcccgagt
attttcactaatgatggtatgccattattaaaaatatctcataaatcaaagaaaagaatt
ttattttggattgacccttcatgtttcaaattttcttggagaatggctaattcaacaacc
accaccacgtcagccaccacatcggccacaacttctggattaccccaaggaattactaat
actaccgcattatctaattcagcaatcatatccacaccagcaatagcaacatcagctatt
catcgattatcaataaccaacagaacgactcatgaatttgctcttgatgatattaaatca
atatatatacaaaatgaaggtagtggatatcgtgaagaattaaatatatctcaaaaactt
gaaaaaaattggatcaccattatatattttaatcataaaaaaaatagtttaaaatcatta
catttaatcactgataatgatcatgattttaaaaaattgattctggcaatttataattta
aaacaattacgttcacaattggcaaaagaatttttaattgatttgaatgaattagatgaa
aattatgttaaaatgttattaaataaagaattactagctggtgataatggtaatgttgat
ggcaatgaagtcgatattcagaaatctcataaacatgttagagagtttcttagttttaat
gatattttaaaatattccaaacgattaaatattaatgttaataccaatcatttacaacaa
attttcgatcaagtactactactactgtcagcaacaacagaaaagcctgttagcaccccc
ttgtttgaaaaggggttaaattttgaacaatttaaacaatttgtttcaatacttaaagat
cggaaagatttacaagaaatttgggattcattagctcaaggtaaagaagttttacaattt
gatgaaattaaaaatttcattattaatattcaaaaagaaaatttcagtgatgatgatgat
aatagtactattaatttaatttttcaaaaatattgtagtaatgataatggatggaataaa
gaaagtttaaatgaatatttattatctagttattcaactccatatcgtgaaatcacccaa
acccaaactaactattatgattatccattaaatgaatattttatttcatcatctcataat
acttatttaactggtcgacaagttgctggtgattcatcagtagaagggtatatacgaaca
ttacaacgtgggtgtcgatgtgttgaaattgatatttggaatggtgatagtaacaccacc
accaccaccgtcattggtacaaaagatgatgatgataagaatgaatatgaaccaatagtt
aatcatggaagaacgtttactaaaccaataagctttgctaatgttataagagcaattaaa
aaatttgctttcattgtatcaccttggccattaatacttagtttggaaattcattgttca
ccggaatgtcaaattaaagtagttaatattttaaaagatattcttggagaaaatatgatt
attgctcctattgatattgattcggtgatattaccatcaccagccgaattgaaacataaa
tttataattaaagtgaaaaagacaacttcatttcaaaatttaatagaaactgaaaatggt
agtttcacaacaagtactactaccaccaccaccaccactactactactactactactgca
acttcattaagtgaagataatgaaaataataaatctaatagtagttctacatcatcattc
attataagacgaaggaaaaataaatcaccaaaaatcatcaatgaattaagtaatcttgga
atctatactcaagggataaaatttcgtaatttttcattaccagaatctaaaacctttaat
cattgtttttcattaggtgaaaaatcaattaatcgaatgattaaagatgatgataaaaaa
atttctttagataaacataatcgtcgttatttaatgagagtttatccactgggaacaaga
ttaaaatcttcaaattttaatccattaccttattggtctcatggtgtacaaatggtagcc
accaattggcaaacttatgatttaggtcaacaattgaatgaagcattatttgaaaataaa
atatttcaaggatatgtattaaaaccaagtgtattaaggaaaccaactttaaaatcaagc
agtagcaatgtcgatacaagaacgtcattaactactactaattctaaaactattcgattt
aattttgaaattataagtggtcatcaattacccaaatttcctaaagatgattataaagat
caagccattaatccatatatatcatttgaaataattggtgctcaagatgttcaatgggat
aataatgacagctcaccaattgcaccaaccaccagttcttctccctttattagaacaacg
aaaataattcgtgaaaatggatttaatccaaattttaatactaaatttagtggttcaatc
atcactactactaatgatttaatatttataaaatttgttgtttatgcatcaacttcttta
aattatcctgattatggggaaaatttccctattgctatattagtcactaaattaaattat
ttaaaacaaggttatagatatatttatctaaatgatttattaggtgaacaattggtttat
tcttcaatatttataaaaattgaatatgatgaagatttattaaatgagttcataaataaa
taa

DBGET integrated database retrieval system