KEGG   Candida albicans: CaO19.558Help
Entry
CaO19.558         CDS       T00189                                 

Gene name
GUT1
Definition
likely carbohydrate kinase similar to S. cerevisiae GUT1 (YHL032C) glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
cal  Candida albicans
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cal00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    CaO19.558 (GUT1)
Enzymes [BR:cal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     CaO19.558 (GUT1)
Exosome [BR:cal04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CaO19.558 (GUT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 631 aa AA seqDB search
MPRRVSNAPCIPVVATIDIGTTSARAIIFSAEGEEIAKHQIEYSTTASEAPENSSNTDQF
RRRSSLLRHDEPIFSAEGIAITLNDNIMIENNKSSVGPTIRFPQPGWVECMPVHILANAV
QCLVACLISLRKVNQDPNLKLKYKVKAIGIANMRETTIVWSRKTGKPLSGGITWTDTRTS
EIIQHLEKMIDEDRKAELKEKTGLPLSTYFSAAKLRWLLDNDDVIREEYEKGDGNLMFGT
VDTWLIYHLTKEKAFVSDITNASRTYFMDLETLDYDDDLLDFWGIDPTKIRMPKIVSSSE
FYGEFAAPKLDNLGFHNKITKEAYDILKTITGVPICGCLGDQSASLVGQLAFSAGSAKCT
YGTGAFLLYNTGPHKLISKRGALTTFGFWFPTLKGTDGKPHYAMEGSIAVAGSIIQWLRD
NLKMIDNAKDIGPLASQVENSGGVVFIPAFSGLYAPYWDGGSRGTIFGMTQYTSAAHIAH
AALEGVCYQVRAILKAMASDAGAVDDFLEDALSCQNTDKLLSTLATDGGMSKADEVLQIQ
ADILGPCVTVKRAQTAECTALGAAIAAGLSFKNEEDRIWKDLDDVVAKISGSSEDVAANS
FTAKLSDENRRKAWKRWEKAVDRAKGWLEDE
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgtcgtgttagtaatgcaccatgtattcctgttgtagctacaattgatattggt
actacttcagcaagagctattatattctcggcagaaggagaagaaattgccaagcatcaa
attgaatattccaccactgcttcagaggccccagaaaactcgtcaaatacagatcaattc
agaagaagatcttctttattaagacatgatgaacccattttctcagctgaaggtattgcc
attactctcaatgacaatattatgattgagaataataaatcatctgttggtcccaccatt
agattcccacaaccaggttgggttgaatgtatgccggttcatattttagctaatgccgtt
caatgtttagtggcttgtttgatatcattgagaaaagttaaccaagatccaaatttaaaa
cttaaatataaagtcaaagccattggtattgccaacatgagagaaaccactattgtttgg
tctagaaaaactgggaaacctttgagtggaggtattacttggaccgatactagaacttca
gaaattattcaacatttggaaaaaatgattgatgaagatagaaaagctgaacttaaagag
aaaactggtttacccttatctacttatttttctgctgccaaattaagatggttgttggat
aatgatgatgttattagagaagaatatgaaaaaggtgatggcaatttaatgtttggtact
gttgatacttggttgatttatcatttgaccaaagaaaaggcatttgtttcagatatcacc
aatgcctctcgtacttatttcatggatttagaaactttagattatgatgatgacttgtta
gacttttgggggattgatcctacaaaaatcagaatgccgaaaattgtatcttcttcagaa
ttttatggggaatttgccgcaccaaaattggacaatttggggttccataataaaatcact
aaagaagcttatgatattttgaaaacaatcactggggtgccaatctgtggttgtcttggt
gatcaatctgcttcacttgttggtcaattggcattcagtgctggttctgccaaatgtact
tatggtactggtgccttccttttatataatactggacctcataaattgattagtaaacgt
ggagcattgaccacttttggattttggttcccaactttaaagggtactgatggtaaacct
cattatgccatggaagggtctattgctgttgctgggtcgattattcaatggttgagagat
aacttgaaaatgattgataatgccaaagatataggtccattagcttcacaagtggaaaat
tctggtggagtggtgtttatcccagcattttctggtctttatgccccatattgggatggt
ggttctagaggtactattttcggtatgacacaatacacatcggctgcacacattgctcat
gctgcattggaaggggtttgttatcaagtaagagctattttgaaagcaatggctagtgat
gctggtgctgtagatgatttcttggaggacgcattatcatgtcaaaacaccgataaatta
ttatctacattagctactgatggtggtatgtctaaagctgatgaagttttacaaattcaa
gcggatattttgggtccttgtgttactgtgaaacgtgcacaaactgctgaatgtactgca
ttgggtgctgctattgccgctgggttatcattcaagaatgaggaagatcgtatttggaaa
gatttggatgatgtagtggccaaaattagtggttcaagtgaagatgtggctgctaattct
tttactgccaaattatcagatgaaaatagaagaaaagcttggaaacgttgggaaaaagct
gtagatagagccaaaggttggttagaagacgaatag

DBGET integrated database retrieval system