KEGG   Candida albicans: CaO19.568Help
Entry
CaO19.568         CDS       T00189                                 

Gene name
SPE2
Definition
S-adenosylmethionine decarboxylase
Orthology
K01611  
S-adenosylmethionine decarboxylase [EC:4.1.1.50]
Organism
cal  Candida albicans
Pathway
Cysteine and methionine metabolism
Arginine and proline metabolism
Metabolic pathways
Module
Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:cal00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    CaO19.568 (SPE2)
   00330 Arginine and proline metabolism
    CaO19.568 (SPE2)
Enzymes [BR:cal01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.50  adenosylmethionine decarboxylase
     CaO19.568 (SPE2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
R
AA seq 382 aa AA seqDB search
MVAPALIYSNHELSTAIDSTHAFEGPEKLLEIWFYESKELSPINLRDIKFDTWIEILNLV
HCEVLSKVSSNLCDAFLLSESSLFVFPHKIILKTCGTTTTLACLDLLFETVNKELLQNEG
LKATFQSKNIYQIFYSRRSFMFPDRQIHVHGNWQEEVKLLNQYFNNGKSYIVGNNTNWHL
YVGGNGKTKNPVASTTTTTTTPVVNDCTLEIIMTQLSLEASQQFYTTRKPGDTAIDSNHD
LGHDLGQEILKQTGLNELFKFKKQPTMPGLSSSPIKEIHDGFAFTPCGFSSNSINESNYY
TIHVTPEPGWSYASFETNMIGDYKAIVDKCINVFQPGQFMVTFLTNTDMEKFECCLDDYK
VNHREELDVEDYKLYFVEFVRQ
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atggttgcaccagctttaatttattccaatcatgaactttctacggcaattgattcaact
catgcttttgaaggtccagaaaaattacttgaaatctggttctatgaatccaaagaatta
tcaccaatcaatttaagagatattaaatttgatacttggatcgaaattttgaatttagtt
cattgtgaagtcctttctaaagtttcttcaaatttatgtgatgcatttttattaagtgaa
tcatcattatttgttttccctcataaaatcattttgaaaacttgtggtactactactacg
ttagcttgtttagatttattatttgaaactgtgaacaaagaattattacaaaacgagggg
ttgaaggcaactttccaaagtaaaaatatttatcaaattttttattctcgtcgttcattc
atgttcccagatcgtcaaatccatgttcatgggaattggcaagaagaagtcaaattattg
aatcaatatttcaataatggtaaaagttatattgtgggtaataataccaattggcatctt
tacgttggaggtaatggtaagactaagaaccccgttgcctctacaacaacaacaacaaca
actccagtggtcaatgattgtactttagaaatcattatgactcaattatctttagaagct
agtcaacaattttatactactagaaagcctggtgatactgccattgattcaaatcacgat
ttaggtcatgatttgggccaagaaatacttaaacaaactggattaaatgaattattcaaa
ttcaaaaagcaaccaactatgcccggtttaagttcatctccaattaaagaaattcacgat
ggatttgctttcactccatgtggattttctagtaattcaattaatgaatcaaattattat
acgattcatgtcactccagaaccaggttggagttatgcatcatttgaaactaatatgatt
ggtgattataaggctattgttgataaatgtattaatgttttccaacctggtcaattcatg
gtgacttttttaactaatactgatatggaaaaatttgaatgttgtttagatgattataaa
gttaatcatcgtgaagaattagatgttgaagattataaattgtattttgttgaatttgtt
cgtcaataa

DBGET integrated database retrieval system