KEGG   Candida albicans: CaO19.579Help
Entry
CaO19.579         CDS       T00189                                 

Gene name
FOL1
Definition
likely pterin binding enzyme similar to S. cerevisiae FOL1 (YNL256W) involved in folic acid and derivative biosynthesis
Orthology
K13939  
dihydroneopterin aldolase / 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:4.1.2.25 2.7.6.3 2.5.1.15]
Organism
cal  Candida albicans
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cal00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
R
AA seq 788 aa AA seqDB search
MLKNDTVFTKDISCTAITGKDAWNRPTPQPITISLSFNTDFHKASELDNLKYSINYAVIT
RNVTEFMKSNEHLNFKSLGNIAQAISDIGLDQSRGGGSIVDVTIKSLKSEIRAESVEYKI
NRNTLGQPVPLDIFQVNKLRLLTIIGVFTFERLQKQIVDVDLQFKIEPNSNLYFHQIIAD
IVSYVESSNFKTVEALVSKIGQLTFQKYDGVAEVVATVTKPNAFSHVEGVGVSSTMVKDN
FKDMEPVKFENTIAQTNRAFNLPVENEKTEDYTGYHTAFIAFGSNTGNQVENITNSFELL
QKYGITIEATSSLYISKPMYYLDQPDFFNGVIKVNFQNISPFQLLKILKDIEYKHLERKK
DFDNGPRSIDLDIILYDDLQLNTENLIIPHKSMLERTFVLQPLCEVLPPDYIHPISAESL
HSHLQQLINDKPQETVQESSDLLQFIPVSRLPVKDNILKFDQINHKSPTLIMGILNMTPD
SFSDGGKHFGKELDNTVKQAEKLVSEGATIIDIGGVSTRPGSVEPTEEEELERVIPLIKA
IRQSSNPDLSKVLISVDTYRRNVAEQSLLVGADIINDISMGKYDEKIFDVVAKYGCPYIM
NHTRGSPKTMSKLTNYESNTNDDIIEYIIDPKLGHQELDLSPEIKNLLNGISRELSLQMF
KAMAKGVKKWQIILDPGIGFAKNLNQNLAVIRNASFFKKYSIQINERVDDVTIKHKYLSF
NGACVLVGTSRKKFLGTLTGNEVPSDRVFGTGATVSACIEQNTDIVRVHDVKEMKDVVCI
SDAIYKNV
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaaaacgataccgttttcactaaagatatttcttgtacggcgataactggtaaa
gatgcctggaatcggccaacaccacaaccaatcactatatcattatctttcaatactgat
ttccataaggcatcggaattggataatttgaaatactcaattaattatgctgttattacc
agaaatgtaactgaatttatgaaatcaaatgagcatttaaatttcaagtcattaggaaat
attgctcaagcaattagtgatattggattagatcaatctagaggtggtggatctattgtg
gatgtgacgataaaaagtttgaaatcagaaataagagctgaaagtgtcgaatataaaatt
aatagaaacactttgggtcaacccgttccattagatattttccaagttaataaattgaga
ttattgacgattattggagttttcacatttgaaagattacaaaaacaaatagttgatgtt
gatttgcaatttaaaattgaacctaattccaatttatatttccatcaaataattgctgat
attgtttcatacgtggaatcatctaatttcaaaactgtagaagcattggtgtctaagatt
ggtcaattgacatttcagaaatatgacggagtagctgaagttgttgctactgtcactaaa
ccgaatgcatttagtcatgttgaaggtgttggagtatcatctaccatggtcaaagacaat
ttcaaagatatggaaccagttaaatttgaaaacacaattgctcaaactaatagagcattc
aatttacctgttgaaaatgagaaaactgaggattataccgggtaccacactgcatttatt
gcctttggatccaatactggaaatcaagtagaaaatattaccaattcattcgaattgttg
caaaaatatggaatcaccatagaagcaacttcatcattgtacatttctaaaccaatgtat
tacttggatcaaccagattttttcaatggagtaattaaagtgaatttccaaaacatttca
cctttccagttgttgaaaattctaaaagatattgaatataaacatttagaaaggaaaaaa
gactttgataatgggcccagatcaatagatttggatattatactatatgacgatttacaa
ttaaataccgagaatctaattattccacataaatcaatgttagaaagaacatttgtatta
caaccattatgtgaagtattgccccctgattatattcatcccatcagtgcagaaagtttg
catagccatttacaacaattaataaatgataaacctcaagagacagtacaagaatcgtct
gatttattacaatttatcccagtctctagattgcctgtcaaagataatattttgaaattt
gatcaaattaatcataaatctcctactttgattatgggtatattgaatatgactcctgat
tcatttagtgatggtgggaaacattttggaaaagaactagataatactgtgaagcaggca
gagaaattagtcagtgagggtgctacgattattgacattggaggagtttccacacgccca
ggaagtgttgaacccactgaggaagaagaattggaacgtgtgattccattaattaaagct
attcgtcaatcactgaaccctgatttactgaaggtgttgatttcggttgatacttatcgt
aggaacgttgctgaacaaagtttacttgtgggtgctgacataatcaacgatatctcaatg
ggcaaatatgatgaaaaaatatttgatgtggttgctaaatacggatgtccttatatcatg
aatcatactcgaggatcacctaaaaccatgtctaaattgaccaattatgaatcaaataca
aatgatgatattatcgaatatataattgatcctaaattaggacatcaagaattggatttg
tcacctgaaatcaagaatttactcaatggaatcagtcgtgaattgagtttacaaatgttt
aaagccatggctaaaggagtgaaaaaatggcaaattattttggatcctggtattggattt
gctaaaaatttgaatcaaaatttagcagttattcgtaatgcctcgttttttaaaaaatat
tctattcaaattaatgaacgtgttgatgatgtgacaatcaaacataaatatttaagtttt
aatggtgcttgtgttttggtggggacatcaagaaagaagtttttggggacattaactggt
aatgaagtgcctctggatcgagtatttggcactggtgcaacagtgtctgcgtgtattgaa
caaaacactgatattgtaagagttcatgatgttaaagaaatgaaagatgtagtatgtata
agtgatgcaatttataaaaatgtataa

DBGET integrated database retrieval system