KEGG   Candida albicans: CaO19.5846Help
Entry
CaO19.5846        CDS       T00189                                 

Gene name
TFB2
Definition
component of RNA pol II transcription initiation TFIIH
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
cal  Candida albicans
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:cal00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    CaO19.5846 (TFB2)
  Replication and repair
   03420 Nucleotide excision repair
    CaO19.5846 (TFB2)
Transcription machinery [BR:cal03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     CaO19.5846 (TFB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 494 aa AA seqDB search
MSSHLFKATVNEYLEGLPKTVQSKLYEAPATCLSIFRLLSPMAKFYIMSMIFNEKPIALR
DLDKWCKPSARKLEFEALKRLESLHLIEYDSKGSHVRLHSIFRKNFRDCLTGSQNPNAFG
SISTTVDKHKVDIPFLDLFASQKWETILHFMVGTESTATPSDSVLSLLKLGGLMEGPNND
LRITNSGFQFLLQDVNAQIWTLLLQYLNLTQELNMDPVDVLNFIFVLGSLELGKSYSVLS
LSETQVSMLADLKDYGLVYQRSDTSGRFYPTRLATTLTSDSAALKTPSMAMDEEEQQVAT
KESIIIETNFKIYAYTKSPLEIAILNLFVHFKTRFANMVCGQITRESIRNALYNGITADQ
IIKFLETHAHPQMRILAKEKLDKKIEFDTSHNINTAGGAPQSKTDGMVSQHKLEILPPNV
VDQIKLWQLELDRIQTFDGYLFKDFSNQQEYDILSNYASELGVLIWADKVKKKFFVTKDG
MTQVADFANRKLKR
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtctcacttgttcaaggcgacggtaaatgaatatctcgaaggactcccgaaaaca
gtccaatccaaactatatgaagcaccagctacgtgtttgtcgatattccgattactttcg
ccaatggccaaattctacatcatgtcaatgatattcaatgaaaaaccaattgcattaaga
gatttagacaaatggtgtaaaccactggcgaggaaattggaatttgaagcattgaagaga
ttggaatctctacatttaatagaatatgatagtaaaggttctcatgtcagattgcattct
attttcaggaaaaactttcgtgattgtttgacaggatcacaaaatccaaatgcatttgga
agtataagtaccacagtggataaacataaagttgatataccattcctagatttgtttgca
tcgcagaaatgggaaactattttacatttcatggtgggtaccgaatcaacggccactcct
tctgattcagttttaagtctacttaaattgggtggattaatggaaggccccaacaatgat
ttaagaattacaaatagtgggttccagtttttgttacaagatgttaatgcacaaatttgg
acattgctattacaatatttgaacttgacacaggaattgaatatggatccagttgatgtg
ttgaattttatatttgtattggggtcattggaattgggtaaaagttactctgtattaagc
ttaagtgaaactcaagtgagtatgttggcagatttaaaagattatgggttggtttatcaa
cgatcagacacttctggaaggttctacccaacaagattggcaaccacgttaacttctgat
tcagcagcattgaagacgccatctatggcaatggatgaggaagaacaacaagttgcaaca
aaggaatcgattatcatagaaacaaatttcaaaatttatgcatacacaaagtcaccatta
gaaatagccattctaaatttgtttgtgcattttaaaaccagatttgccaatatggtatgt
gggcaaattacaagagaatctataagaaacgccttatataatggtataactgcagatcag
attatcaaatttttggaaacccatgcacatccacaaatgagaatattagcaaaagagaaa
ttggataaaaaaattgaattcgataccagtcacaatatcaatactgctggtggtgctcct
caaagtaaaactgatgggatggtttcacaacataagttggaaatactccctcctaatgtt
gttgatcagatcaagctatggcagttggaattagatagaattcaaacttttgacggatac
ttgtttaaagatttctccaatcaacaagaatatgatatattatctaattatgcttctgag
ctaggggtattgatctgggcagataaagtgaagaagaaattctttgtcactaaagacggc
atgactcaagttgctgattttgcaaacagaaaattgaaacgttga

DBGET integrated database retrieval system