KEGG   Candida albicans: CaO19.5862Help
Entry
CaO19.5862        CDS       T00189                                 

Gene name
AFP99
Definition
Arginase/agmatinase family protein similar to S. pombe SPAC11D3.09; weakly similar to S. cerevisiae CAR1 (YPL111W)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
cal  Candida albicans
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cal00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    CaO19.5862 (AFP99)
Enzymes [BR:cal01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     CaO19.5862 (AFP99)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 418 aa AA seqDB search
MKLYIFVLVACVSSQTIFRSPSLLDQLYGELHGRTNTAPNLQVQAEDPNQMVTQKVLAMR
SKLTLPDKDDTSDIAIDQNMFGGILTYAHFNHFNCFISDDFDKHSTTDQQTTKNIDIAIV
GAPFDTGTSYRPGARFGPESIRSNSRRLGSAWKSTKKRFNYPVNPYDETTHNYSIIDCGD
VAMTPFDNRIALNQLYRGHRSISKHPGNVNQHPKIITLGGDHTITLMAIKNAHEQLRTKI
RVFHFDSHIDTWDPKKLGGGITDYMSLNHGTFLHYATELGYIETKGNYHVGIRAPYIDAN
YDKQHDADCGFHIIQANDIDKIGVQGIIDELAKDPNIPTYISVDIDVLDPAYAPGTGTME
AGGFTTRELLSILDGLKNKVNVIGGDVVEVSPPYDTNSEITSLAATSVVDSLLKLMIV
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgaaactttacatttttgttttggttgcatgtgtgtcatcacaaaccattttcagatca
ccatcacttcttgatcaattatatggagaattacatggaagaacaaacacagcaccaaat
ttgcaggtacaagcagaggatccaaatcagatggtcacacaaaaggttttagcaatgaga
tccaaattgacgttgcctgataaagatgatacttccgatattgctattgatcagaatatg
tttggtggaatcttgacttatgcccatttcaatcatttcaattgtttcatttctgatgac
tttgataaacactccactacagatcaacaaacaaccaaaaatattgatatcgctattgtt
ggggcacctttcgatactggaacatcctatcgcccaggagctagatttgggcccgagtca
attagaagtaattcccgacgtctaggaagtgcttggaaatcaaccaaaaaaagattcaat
tacccagttaacccatatgatgagaccactcataattactctattattgattgcggtgat
gtggctatgactccatttgataatcgcattgctttaaatcaattgtaccgtggacataga
agtatttctaaacacccagggaatgtcaatcaacatcccaaaattatcacattgggcggt
gaccataccatcaccttaatggcaataaagaacgctcatgaacaattgaggacaaaaatt
agagtatttcattttgattcacatatcgatacctgggatcctaagaaattaggtggtgga
atcactgattatatgtcattgaatcatggaacattcttgcactacgctactgaattagga
tacattgaaacaaaaggcaactatcatgtcgggataagagcaccgtatatcgatgctaat
tacgacaaacagcacgatgctgattgtggattccatattatccaagctaatgatattgac
aagattggagttcaagggatcattgatgagttagcaaaagatccaaacattccaacttac
atatcagttgatatagatgtattagacccagcctatgcaccaggaacgggaacaatggaa
gctggcggattcacgaccagagaattgttgagcattttggatgggttgaaaaataaggtt
aacgttattggtggtgatgttgtggaagtgagtcctccatatgatacaaatagtgaaatc
accagtttggcagccaccagtgttgtcgattcattattgaaattaatgattgtctaa

DBGET integrated database retrieval system