KEGG   Candida albicans: CaO19.6063Help
Entry
CaO19.6063        CDS       T00189                                 

Gene name
UBP6
Definition
ubiquitin-specific protease
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.1.2.15]
Organism
cal  Candida albicans
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 412 aa AA seqDB search
MVLGTPDKNLPSKPVEKQVFLEDLNKNQLVKVSNEPSGLTNLGNTCYLNSSLQTIFHIDD
VNNRLKDYTFGGANQANSAFVLSLKSMFQQMSKKQEVITPSTFLSLFRRSYPQFAEQQNG
IYKQQDAEEAFSQILSSLRSELKIDDVFKITFNTKTQCLAIPEDVTEGFEEAYKLNCHIG
VKTNFLRDGLLAGLKETIEKHNSTLNADTEYETTKTITRLPKYLTVHFIRFFWKRDINKK
SKILRKVQFPFELDLAEMLDVSIKADKVSNRDTIRKVEKDNLDMIRDFKKTKNDTSLTPL
EQQEEDEMKITSIKSKFKDDLNSALPNVDFNTTTENPSSVYELNAVITHAGSSADGGHYK
AYVKDPTDLDGERWWLFNDDKVSSVNKEKIETLAGGGESDSALLLIYKGLGL
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atggttttaggcactccagacaagaatttgccttcaaagccagttgaaaaacaagttttt
ctcgaagatttgaataaaaatcaattggttaaagttagtaatgaacctagtgggttgacc
aatttagggaacacttgttacttgaactcaagtttacaaacaatattccatattgatgat
gtgaataacaggttgaaagattacacttttggtggagccaatcaagccaatagtgccttt
gtgttgtcattgaaaagtatgttccagcaaatgtcgaaaaaacaagaagttataactcct
tctacatttctttctcttttcagaagatcttatcctcaatttgctgaacaacaaaatggt
atttataaacaacaagacgccgaagaagcattttcccaaattttgagctctttgagaagc
gaattgaaaatagatgatgtgttcaaaattacatttaacaccaagactcaatgcttggct
attccagaagatgtcacagaagggtttgaagaagcatataaattgaattgtcatatcggc
gtcaagaccaattttttgagagatggattgttggctggattaaaagaaacgattgaaaaa
cataattcaactttgaatgctgatactgagtatgaaacaaccaagaccataactagatta
ccaaaatacttgacagtacattttattagatttttctggaaacgagacatcaataagaaa
tccaagattttgagaaaggttcaattcccatttgaattagatttagcagaaatgttggat
gtatcaataaaggcagataaagtttccaatagagatacaattagaaaagttgaaaaagat
aatttggatatgataagagatttcaaaaagaccaaaaatgacaccagtttaacaccattg
gaacaacaagaggaggatgagatgaaaataacatcaatcaagagtaagtttaaagacgac
ttgaatagcgctttgcccaacgttgattttaacaccaccacagaaaacccttctagtgtg
tatgaattaaacgcagtcattactcatgctggatcatctgccgatggtggtcattataaa
gcatacgtcaaggatccaacagacttggatggcgagagatggtggttatttaacgatgat
aaggtgagctccgtaaacaaagaaaagatcgaaactttagctggcggtggtgaaagcgac
tcagctttattattgatttacaaaggcttagggctttag

DBGET integrated database retrieval system