KEGG   Candida albicans: CaO19.6260Help
Entry
CaO19.6260        CDS       T00189                                 

Gene name
UBP12
Definition
potential ubiquitin-specific protease similar to S. cerevisiae UBP12 (YJL197W)
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
cal  Candida albicans
Brite
Enzymes [BR:cal01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     CaO19.6260 (UBP12)
Peptidases [BR:cal01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CaO19.6260 (UBP12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 1372 aa AA seqDB search
MPDNIEDRSEIPSDAKEIVTTNEIEATDSEHTTNVDNELPQGESNEQTGDDSNDNLASKR
QLINDLLHNDHFEEGTERYIIPQNFLHEFLNLPIDNFSDLKDQLGPIDFHSLLNEQGNLY
PENEEPVTFCHVSPEVFQHLGEWFGILGQPIIRAIIINPDTKEKQIERFPPLFWVHQLGK
KTQPTYLRHRHNGSNHNHHHHGHHDSPIPVLLSKTSTFHRLMDVIRYNVLKAPRKSTKDF
RIWFIVPQDKGLQYLISIQTFMFDISKKTLVSPNMLEDALKDHGIVASSYNIMVEAKEKH
QTEFPIDQFILSHSNAYEEVSQGGGHLGLSNMGNTCYMNSALQCLLHVPEINYYFFYNIY
KKELNFDNPLGYHGDVANAFGSLLKQAFDHVKNSSSISPREFKSTIGRYSSMFSGYLQQD
SQELLSWLLDALHEDLNRIHQKPYCEKPELKDDEIDDPQAITKLANTCWNQHKARNDSVI
IDLFTGLYQSTLICPDCGKKSITFDPFNDLTLPLPISKKWYHTFTIVDLSNQGVIPERIM
KLEVELNKTSNFDDLLSYLSNFLNVPSTELFAYEIFQNAIYSDFQLDYTKNKFLPISDII
RDTDDVIVYIVPHNPAVDIIVPVFNAVEDADSSYQMVNFFGIPLFVVMNKEVDVNSFGFI
RKKLLETVSLLSKIDLVDEYEKIKRSNEDYVEKVFYKKSDFPALSQPLETSDCEKNNNNT
SDNDDDEDADNDEGYDSEVSLANPYLGANFGFKIMYVHDYSPKLNSNLRSRYNHDQTTKF
KQTERVINVPTHKPTFSDFKPLSDQLSESKRNYYFYPDYKKMDDEMDQLVEEVNQNLAEQ
EEARSSGSENSSRASEEQDGFVLINKEDTLKQQSTVPAAAETVPPPLPVRNNTGVHIPSS
DEETESEANLGSLFDSTSNLPLPPPSTYSESTKPSNVNSPMESNFESSSADLNSGTTLIS
KDTVLLCDWDKEIYQKCFGDKELQAWENISNLPNPELEKNRAHFERQRKAKITLSDCLKS
FSTPEILGEHDLWYCPRCTEHKRATKTIQLWSTGDILTIHLKRFHSARAFSDKIDVLVDF
PIEGLDISSYVANTDLTPEDCLYDLIAVDNHYGGLGGGHYTASVKNFRDDKWYYFNDSRV
TEINNPQEVVANSAYLLFYRRRSSKGAGILGGENFIDLLQKGREEYSESLQKKRLVLQNV
GQIVNTYAKIEQDIIDKETEKQKEEQEQEQEQEQEQEQEQEQEPDQEPDQEQEPDQEPDQ
DQDQEPDQEPDQDQEQNETIKKSRPFDELKPSTSETNNQQQTTQFNFDDEDNDYDYEAEV
EDSNIRKQRLLSKENNSNKLVHIKSNGRQEVTSSPVPIETDGDTDVTDSNST
NT seq 4119 nt NT seq  +upstreamnt  +downstreamnt
atgcctgacaatatagaagatcgatccgagataccttctgatgcaaaggaaattgtgact
acaaatgaaattgaagcaacagattcagaacatacaacaaatgtcgataatgaactccct
caaggtgaatccaatgaacaaacaggagatgactcaaatgacaaccttgcatccaaacgt
caattaatcaatgatttattacacaatgatcattttgaagaaggaactgaacgttacatc
atccctcaaaatttcttacatgaatttttgaatttgccaatcgataattttagtgattta
aaagatcaacttggtcctattgatttccactcattacttaatgaacaaggtaatttatat
cccgagaatgaagaaccagtcactttttgtcatgtatcgccagaagtatttcaacatttg
ggtgaatggtttggaatattgggccaaccaattattagagctattattattaatccagac
accaaagaaaaacagattgaaagattcccgccattattttgggttcatcaattaggtaaa
aagacgcaaccaacatacttgcgacaccgtcataatggaagcaaccacaatcatcatcac
catggtcatcacgattcaccaataccagtattgctttccaaaacaagcacttttcataga
ttaatggatgttatacgttataatgttcttaaagcaccacgaaaatcgacgaaagatttt
aggatttggtttattgtcccacaagataaaggcttacagtatttgatttcaatacaaact
tttatgtttgatatctccaaaaaaactttggtttcaccaaatatgcttgaggatgctttg
aaagatcacggtattgtggccagttcctataatataatggtagaagcaaaagaaaaacat
caaacagaatttcctattgatcaatttattttatctcattctaacgcatatgaagaagta
tcacagggtggtggacaccttggattatcaaacatggggaacacatgttatatgaactcg
gctttacaatgtttattacacgttcctgaaatcaactattattttttttacaacatttat
aaaaaagaattgaattttgacaaccccttgggatatcatggagatgttgccaatgcattt
ggttcacttttaaaacaagcatttgatcacgtgaaaaatagttctagtatatctcctcga
gaattcaaatcaactattgggagatattcctcgatgttttctgggtatcttcaacaagat
tctcaagagttgttgagttggctattagatgctcttcatgaggatttgaatagaattcac
caaaaaccatattgtgaaaagcccgaattgaaagatgacgaaattgatgacccccaagcc
atcaccaaacttgccaatacttgctggaatcaacataaggcaagaaacgactcggtgata
attgatttatttactgggttgtatcaatctacattaatctgtcctgattgtggtaagaaa
tccataacttttgatccctttaatgatttaactttacctttacccatcagtaagaaatgg
tatcacacatttacaattgttgatttgtccaatcaaggcgttataccggaaaggataatg
aagttggaagttgagttgaataaaacatccaattttgatgatttacttagctatttgagt
aatttcttgaatgttccatctactgagttgtttgcttatgagatttttcaaaatgcaatc
tatagtgacttccaattagattacaccaagaacaagtttttacctatcagtgatattatc
agagatacagatgatgttatagtgtacattgttccacataaccctgccgttgacatcatt
gtgccagtgttcaatgccgttgaagatgctgatagttcatatcaaatggttaattttttt
ggaatcccattatttgtggtgatgaataaagaagtcgatgtcaatagttttggttttatt
agaaagaaattattagaaacagtttctttattgagtaaaattgatttggttgatgaatat
gaaaaaataaaaaggagtaatgaagattacgttgaaaaagtattttacaaaaaactggat
ttccctgcattgtcacagccattagaaacctccgattgtgaaaaaaacaacaataatact
agcgacaacgacgacgatgaggatgctgacaacgatgaaggctatgatagtgaagtgtct
ttggctaacccataccttggagctaattttgggttcaaaatcatgtatgttcatgactat
agccctaaattgaattctaaccttcgtagcaggtacaatcatgaccaaacaaccaaattc
aaacaaacagagagagttattaatgttcctacacacaaacctacttttagcgatttcaaa
cctttatcggaccaattatcagaatcaaaacgcaactattatttttatcctgattataaa
aagatggatgatgagatggaccaattggtggaggaagtgaaccaaaatttggcagagcaa
gaagaagcgagatcatcgggttcagaaaatagtagtagagcactggaagaacaagatgga
tttgtattaataaataaagaggatactctcaagcaacaatcaactgtacctgctgctgct
gaaacggtacctccaccattacctgttagaaataatactggagttcacatcccgtcatcc
gatgaagaaacagaaagtgaagctaatttgggaagtttgtttgattcaacatcaaactta
ccgttgcctccaccatctacatattccgaatcaacaaaaccttcgaatgtaaactcacct
atggaaagtaactttgaaagttcatcagcagacttgaattctggtacaacattgatatcg
aaggacacagttttgttatgtgattgggataaggaaatttatcaaaaatgctttggtgat
aaagaattacaagcatgggaaaacatatcgaatttaccgaatccagaattggagaaaaat
agagctcattttgaaagacaaagaaaagctaaaattacattatctgattgtctcaagagt
ttcagtacccctgaaattttaggtgaacatgatttatggtattgtccacgttgtactgaa
cataaacgtgccacaaagacaatccaactttggtcaacgggtgatatcctcactattcat
ttgaaaagatttcatagtgctcgtgcatttagtgataagattgatgttttggttgatttc
ccaattgaaggtttagatataagttcgtatgttgccaatactgatttgacacctgaagat
tgtttatacgacttgattgccgttgataatcattatggtgggttaggaggtggtcattac
actgcctcggtaaagaatttcagagatgataaatggtattattttaatgatagtcgagtc
actgaaattaataatcctcaagaagtcgtagctaattctgcgtaccttttattttaccgt
cgaagaagttcgaaaggagctggtattttgggaggagaaaactttatcgacttgcttcaa
aaaggtcgagaggaatactctgagagtttgcaaaagaaaagattggttcttcaaaatgtt
ggccaaatagtcaatacgtatgccaaaattgaacaagatataattgataaagaaacagag
aaacagaaagaggaacaagaacaggaacaggaacaggaacaggaacaggaacaagagcaa
gagcaagagccagatcaagagccagatcaagaacaagagccagatcaagagccagatcaa
gatcaagatcaagagccagatcaagagccagatcaagatcaagagcagaatgaaacaata
aaaaaatctagaccattcgatgaactcaaaccatcaactagtgaaacaaataaccaacaa
caaacaactcagttcaactttgatgatgaagataatgattacgattatgaagcagaagta
gaagattccaatattcgcaaacaaagattactttcaaaagaaaataacagcaataaattg
gtgcatattaaaagcaatggtcgccaagaagtcacttcatcaccagtaccaattgaaact
gatggtgacactgatgtaactgattccaattcaacatag

  All links  
No link information was found.   
DBGET integrated database retrieval system