KEGG   Candida albicans: CAALFM_C106390WAHelp
Entry
CAALFM_C106390WA  CDS       T00189                                 

Gene name
CaO19.6272
Definition
(RefSeq) ubiquitin-specific protease
  KO
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
cal  Candida albicans
Brite
Enzymes [BR:cal01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     CAALFM_C106390WA (CaO19.6272)
Peptidases [BR:cal01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   CAALFM_C106390WA (CaO19.6272)
Ubiquitin system [BR:cal04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UCH
    CAALFM_C106390WA (CaO19.6272)
  UBL-specific proteases (ULPs)
   CAALFM_C106390WA (CaO19.6272)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
1
AA seq 258 aa AA seqDB search
MTKGDSKRVIPLESNPFLFTELAYQLGLSPILQFHDVYSLTDPDLLAMLPTPIYAIILLF
PLSPNYEKYRQQQDNNNNNNFNSTNLIKYDNNNDIEWFKQTIGNGCGLYALLHILTNLPQ
DLIISNSKLSQLRNNLTKVKEFSIDDRAKIIENLENDIKLDENFGEKGDTKAPDINESVD
LHFISFIKSTKNGHLYELDGRRTGPIDLGESNNKDNNNNNNNIINDPLLIEKIQFYIDNA
DEANKNNFAIMAIGPSFD
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaggtgattctaaaagagtgattccattagaatcaaatccatttttattcacc
gaattagcttatcaattaggattatcaccaatattacaatttcatgatgtttattcttta
actgatcctgatttattagcaatgttaccaacaccgatatatgccattatattattattc
ccattaagtcccaattatgaaaaatatcgtcaacaacaagataacaacaacaacaacaac
ttcaattctacaaatttgataaaatatgataataataatgatattgaatggtttaaacaa
acaattggtaatggatgtggattatatgctttattacatattttaactaatctacctcaa
gatttaatcatttcaaattctaaattatcacaattaagaaataatttgaccaaagttaag
gaattttctattgatgatcgagcaaaaattattgaaaatttagaaaatgatattaaatta
gatgaaaattttggtgaaaaaggtgatactaaagctcctgatattaatgaatcagttgat
ttacattttatttcatttattaaaagtacgaaaaatggtcatttatatgaattggatggt
agaagaactggtcctattgatttaggtgagtcgaataacaaggacaataataataataat
aataatattattaatgatcctttattgattgaaaaaattcaattttatattgataatgct
gatgaagcaaataaaaataattttgcaattatggctattggtccttcctttgattga

DBGET integrated database retrieval system