KEGG   Candida albicans: CaO19.6285Help
Entry
CaO19.6285        CDS       T00189                                 

Gene name
GLC7
Definition
potential calcineurin-like phosphoesterase similar to S. cerevisiae GLC7 (YER133W) protein phosphatase involved in glycogen accumulation
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
cal  Candida albicans
Pathway
mRNA surveillance pathway
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:cal00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    CaO19.6285 (GLC7)
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    CaO19.6285 (GLC7)
Enzymes [BR:cal01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     CaO19.6285 (GLC7)
Protein phosphatases and associated proteins [BR:cal01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     CaO19.6285 (GLC7)
Transcription machinery [BR:cal03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     CaO19.6285 (GLC7)
Spliceosome [BR:cal03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    CaO19.6285 (GLC7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 330 aa AA seqDB search
MSNNIEDDSISVDNIVDRLLEVRGSRPGKQVTLTENEIRFLCTKAREIFIQQPILLELEA
PIKICGDIHGQYYDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPEN
FFILRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIIDEKIFTMHGGLS
PDLNSMEQIRRVMRPTDIPDVGLLCDLLWSDPDKDITGWSENDRGVSFTFGPDVVSRFLQ
KHDMDLICRAHQVVEDGYEFFSKRQLVTLFSAPNYCGEFDNAGAMMSVDESLLCSFQILK
PADKKPRYAPANVANNRPGANQRKPKKAVK
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaacaatatcgaagacgattccatttccgttgacaatattgtcgaccgtcttttg
gaagtgagaggatcaagacccggaaaacaagttacattaaccgaaaatgagattagattc
ctttgtactaaggcccgtgaaattttcatccaacaacctattcttttggagttagaggca
ccaatcaagatttgtggtgatatccatggacaatattacgatctactccgtttattcgaa
tatggtggcttcccccctgaagccaactacttatttttaggggactacgttgatcgtggt
aaacaatcattagaaacaatttgccttttacttgcctacaagatcaaatatccagaaaat
tttttcattcttcgtggtaaccacgaatgtgccagtatcaaccgtatctatggattctac
gatgaatgtaaaagaagattcaatataaaattatggaagacttttacagattgtttcaat
tgtcttccaatcgctgccataattgacgagaaaatcttcaccatgcatggaggtttgtct
ccagatttgaattctatggaacagatcagaagagtaatgagaccaaccgatatcccagat
gtcgggttgttgtgtgatttattatggtcagatcccgataaggacatcactggatggtcg
gagaatgaccgtggtgtgtcgtttacttttggacctgatgttgtgtctcgatttttacaa
aaacatgatatggacttgatctgtcgtgcccatcaagttgttgaagacggatacgagttt
ttcagcaaacgacaattggtaacattgttttcagcaccaaactattgtggtgaattcgac
aatgctggtgccatgatgtcagttgatgaaagtttgttatgttcgttccaaattttgaaa
ccagcagacaaaaaaccaagatatgccccagcaaatgtggctaacaatcgaccaggagcc
aatcaaagaaaaccaaagaaggctgtgaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system