KEGG   Candida albicans: CAALFM_C600170CAHelp
Entry
CAALFM_C600170CA  CDS       T00189                                 

Gene name
CaO19.6319
Definition
(RefSeq) mRNA-binding ubiquitin-specific protease
  KO
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.4.19.12]
Organism
cal  Candida albicans
Pathway
Mitophagy - yeast
Brite
KEGG Orthology (KO) [BR:cal00001]
 Cellular Processes
  Transport and catabolism
   04139 Mitophagy - yeast
    CAALFM_C600170CA (CaO19.6319)
Enzymes [BR:cal01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     CAALFM_C600170CA (CaO19.6319)
Peptidases [BR:cal01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CAALFM_C600170CA (CaO19.6319)
Ubiquitin system [BR:cal04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    CAALFM_C600170CA (CaO19.6319)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 660 aa AA seqDB search
MTSSSSNSGSSRFRGDAASFSPSQYPNYHQQQFHPQQYMAQQIPAQQQFYYQFPQTYPMM
MNQMYPVFPYPPDPFFQQQQQQQQQQQQQQQFVMQPQYIYHPPPKPPKTNKPPKVNGSAP
PPKIELVDLPLYINTSKTEFLQRYSITQESRSIDELQRANTLEEYNENTNRLIISTNVMK
IIDENDHKTTITNGQPEEPKPAAKAVAPPVPISNWASFLQSTAPPTPKKIAKPKPPPTPP
TPVQAVTPVPQFDMSNESAQPLGTLLLKIMFDSNYSVFSSLPTFDIKPRGLTNTGNICYM
NSILQILIHCEPFNRLLKLIETKSIGSLGPSSTPLLDATIIFFNQFQENVKGAISPESFY
ASLTKLDKFSHLKWGQQEDAEEFLGYYLDGLNEEFLGAIKQLNTPQIDSLIQVYAQDHDA
EATAKFKFNVKSTIKRIKNDAEADDGEWNQVNKKKNSTTTKIEIDPTPLNMIFGGEFKSV
VTIPKQSSSFQKSITLDPFQHVQLDVSSADTIEDAIKHLNESESISYTNNNKEIQVKKQT
FIEKLPNVLIIHLKRFSYLKDQEIGVEKLRKKVDYNHDLIIPKEVMARDTGMPIKYQLVS
VVYHHGSSADAGHYTSDIYNAGQWWRIDDTAVKQIQNEEVLNAGTEENIKNAYILLYRRI
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgacatcttcatcatcaaactcagggtcactgcgctttcgtggagacgcagctagcttt
tcacctagccaatacccaaactaccaccagcaacagtttcacccacaacaatatatggca
cagcagattcctgcacaacaacagttttactatcagtttcctcagacatatcccatgatg
atgaatcagatgtatccggtgtttccctatccgccagatcccttttttcaacaacaacaa
caacaacaacagcaacaacaacagcaacaacaatttgtaatgcagccgcagtatatctat
catccaccgccaaaacctcccaaaactaataaaccaccaaaagtgaatggcagtgcacca
ccaccaaaaatcgaattagtggatctccccttgtacattaatacttcgaaaaccgaattt
cttcaaagatacagcataacccaagagtcacgttctatagacgagcttcaacgagccaat
acattagaggaatacaacgaaaacactaatagattaattatcagcactaatgtcatgaaa
ataatagatgaaaatgatcacaaaactaccattacaaatggacaacccgaagaacccaaa
cccgctgccaaagctgtagcaccacctgtgcctattagtaattgggccagtttccttcaa
tcaactgcaccaccaaccccaaaaaagatagctaaacccaaaccaccaccaactcctcca
accccagtccaggcagtaacaccagttccgcaatttgatatgagcaacgaatctgcacag
cctttggggacattattgctcaaaatcatgtttgatagcaactactctgttttcagcagc
ttgccaacatttgatataaaacctagaggattgactaacaccggcaacatttgttatatg
aattctatattacagattttgatccactgtgagccattcaatagattgctaaaacttata
gagaccaagtccataggaagtttgggcccatcttcgacgccattactagatgccaccata
atttttttcaatcagtttcaagagaatgttaagggcgctattctgcccgaaagtttctat
gccagcttgaccaagcttgacaagttttcacatttgaaatggggacaacaggaggatgcc
gaagagtttttggggtactaccttgatggacttaatgaagagtttttaggggctatcaaa
caattgaacacgccccaaatcgattccttgatacaggtatatgcacaagaccacgatgct
gaagccactgccaagttcaagtttaatgtcaaatctactatcaagagaatcaagaacgat
gctgaggccgacgacggcgaatggaaccaggtgaataagaaaaagaatagcacaaccacc
aaaatagaaatcgacccgaccccgctaaatatgatttttggcggtgagttcaagtccgtg
gttactatacccaaacaatcgtcgtcgttccagaaatccataacgctagaccctttccaa
cacgtgcagttggatgtatcgtcagcagacactattgaagatgcaatcaagcatttgaat
gagtcggaaagcataagttatacaaacaacaataaagagatccaagtgaagaagcagacg
tttattgaaaagttgcctaatgtattgataatacatctaaaacgattcagttacttgaaa
gaccaggagattggggtggagaagttgaggaagaaagtggattataaccacgatttaata
ataccgaaagaggtaatggcaagggatacggggatgccgatcaaataccagttggtgtcg
gttgtttaccaccacggaagtagtgcagatgctggacattataccagtgacatatacaat
gcaggccaatggtggagaatagatgatactgctgtgaagcagatacagaatgaagaggtt
ttgaatgctggcacagaggagaatataaagaatgcgtatatattattgtataggagaatc
taa

DBGET integrated database retrieval system