KEGG   Candida albicans: CaO19.6319Help
Entry
CaO19.6319        CDS       T00189                                 

Gene name
UBP3
Definition
(RefSeq) ubiquitin-specific protease
  KO
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.4.19.12]
Organism
cal  Candida albicans
Brite
Enzymes [BR:cal01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     CaO19.6319 (UBP3)
Peptidases [BR:cal01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CaO19.6319 (UBP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 482 aa AA seqDB search
MKIIDENDHKTTITNGQPEEPKPAAKAVAPPVPISNWASFLQSTAPPTPKKIAKPKPPPT
PPTPVQAVTPVPQFDMSNESAQPLGTLLLKIMFDSNYSVFSSLPTFDIKPRGLTNTGNIC
YMNSILQILIHCEPFNRLLKLIETKSIGSLGPSSTPLLDATIIFFNQFQENVKGAISPES
FYASLTKLDKFSHLKWGQQEDAEEFLGYYLDGLNEEFLGAIKQLNTPQIDSLIQVYAQDH
DAEATAKFKFNVKSTIKRIKNDAEADDGEWNQVNKKKNSTTTKIEIDPTPLNMIFGGEFK
SVVTIPKQSSSFQKSITLDPFQHVQLDVSSADTIEDAIKHLNESESISYTNNNKEIQVKK
QTFIEKLPNVLIIHLKRFSYLKDQEIGVEKLRKKVDYNHDLIIPKEVMARDTGMPIKYQL
VSVVYHHGSSADAGHYTSDIYNAGQWWRIDDTAVKQIQNEEVLNAGTEENIKNAYILLYR
RI
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataatagatgaaaatgatcacaaaactaccattacaaatggacaaccggaagaa
cccaaacccgctgccaaagctgtagcaccacctgtgcctattagtaattgggccagtttc
cttcaatcaactgcaccaccaaccccaaaaaagatagctaaacccaaaccaccaccaact
cctccaaccccagtccaggcagtaacaccagttccgcaatttgatatgagcaacgaatct
gcacagcctttggggacattattgctcaaaatcatgtttgatagcaactactctgttttc
agcagcttgccaacatttgatataaaacctagaggattgactaacaccggcaacatttgt
tatatgaattctatattacagattttgatccactgtgagccattcaatagattgctaaaa
cttatagagaccaagtccataggaagtttgggcccatcttcgacgccattactagatgcc
accataatttttttcaatcagtttcaagagaatgttaagggcgctattctgcccgaaagt
ttctatgccagcttgaccaagcttgacaagttttcacatttgaaatggggacaacaggag
gatgccgaagagtttttggggtactaccttgatggacttaatgaagagtttttaggggct
atcaaacaattgaacacgccccaaatcgattccttgatacaggtatatgcacaagaccac
gatgctgaagccactgccaagttcaagtttaatgtcaaatctactatcaagagaatcaag
aacgatgctgaggccgacgacggcgaatggaaccaggtgaataagaaaaagaatagcaca
accaccaaaatagaaatcgacccgaccccgctaaatatgatttttggcggtgagttcaag
tcggtggttactatacccaaacaatcgtcgtcgttccagaaatccataacgctagaccct
ttccaacacgtgcagttggatgtatcgtcagcagacactattgaagatgcaatcaagcat
ttgaatgagtcggaaagcataagttatacaaacaacaataaagagatccaagtgaagaag
cagacgtttattgaaaagttgcccaatgtattgataatacacctaaaacgattcagttac
ttgaaagaccaggagattggggtggagaagttgaggaagaaagtggattataaccacgat
ttaataataccgaaagaggtaatggcaagggatacggggatgccgatcaaataccagttg
gtgtcggttgtttaccaccacggaagtagtgcagatgctggacattataccagtgacata
tacaatgcaggccaatggtggagaatagatgatactgctgtgaagcagatacagaatgaa
gaggttttgaatgctggcacagaggagaatataaagaatgcgtatatattattgtatagg
agaatctaa

DBGET integrated database retrieval system