KEGG   Candida albicans: CaO19.6344Help
Entry
CaO19.6344        CDS       T00189                                 

Gene name
RBK1
Definition
similar to Ribokinase; phosphorylation of adenosine to AMP
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
cal  Candida albicans
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:cal00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CaO19.6344 (RBK1)
Enzymes [BR:cal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     CaO19.6344 (RBK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 390 aa AA seqDB search
MSSSNPSITIIGSLNYDLVTYTNKVPQGGETYQANSFETHVGGKGLNESIAVAKLTPKNS
VLLSSTTTTTTTSGDGDGAIRMVGKIGDDSFGQQLKQFLIDNKVNVDHVHTVNNQTSGVA
VILVEEETGENRILITSGANGELKLDEKEYESIFPKTTGSITTTKEGEGGYLSFVILQNE
YPDTVKSINWIKSNRPQLNIAYNPSPFKSELITKELLSKIDLLIVNEGEALDVANHLLKN
SHQQDLIDKINQINKSNVPNSTGDNHTLLVEVFSKLAIELQKLINPDNVQIIVITMGSKG
SIYIAKNSGGCGGSGGSQTTPQFIKSRKVEKVIDTTGAGDTFFGAIVSNLALGKSIDYAI
KFATTASSLTIQKKGAAEGIPSYEEVMEIL
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcctccaatccatcaattactattattggatcattaaattatgatttagtcaca
tatacaaataaagttccccaaggtggagaaacttatcaagcaaattcatttgaaactcat
gttggaggtaaaggattaaatgaatctattgccgttgccaaattaactcctaaaaattcc
gtattattgagcagtactactactactactactactagtggtgatggtgatggtgctatt
cgtatggtgggtaaaattggtgatgattcatttggtcaacaattgaaacaatttttaatt
gataataaagttaatgttgatcatgttcacacggtgaataatcaaacttcaggagttgcg
gtgattttagtagaagaagaaactggtgaaaatcgaattttaatcactctgggagcaaat
ggtgaattaaaattagatgaaaaagaatatgaatcgattttccccaaaactactggaagc
atcaccaccaccaaagaaggggagggggggtatctctcatttgtgattttacaaaatgaa
tatcctgatacggttaaatcgattaattggataaaatccaatcgtccacaattaaatatt
gcctataatccatcaccatttaaatcagaattaattactaaagaattattatcaaaaata
gatttattaatagttaatgaaggtgaagcattagatgttgctaatcatttattaaaaaat
tctcatcaacaagatttaattgataaaattaatcaaatcaacaaaagtaatgtcccaaac
tctactggcgataatcatacattgttggttgaagtgtttctgaaattagccattgaatta
caaaaattaattaatcctgataatgtacaaattattgttataactatgggtagtaaagga
tctatttatattgccaaaaatagtggtggttgtggtggtagtggtggtagtcaaaccact
ccacaattcattaaatctagaaaagttgaaaaagtcattgatacaactggagcaggtgat
acatttttcggagcaattgtactgaatttagcattaggtaaactgattgattatgccatt
aaatttgcaactactgcgagtagtttaacaattcaaaagaaaggtgccgctgaaggaatt
ccaagttatgaagaagtaatggaaattttgtag

DBGET integrated database retrieval system