KEGG   Candida albicans: CaO19.6540Help
Entry
CaO19.6540        CDS       T00189                                 

Gene name
PFK2
Definition
phosphofructokinase beta-subunit that can functionally substitute for S. cerevisiae PFK2 (YMR205C)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cal  Candida albicans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 946 aa AA seqDB search
MISIVNGTSTLSLVAGSVETLNQAINFYTNILGLSVHSEQNDWTYLSNDDNKMIVKIQLD
TKSGLSLDQINDRRTEIIAKLNITDWRSLDTTSVLKVQNLVALIETLTTFNYTLQITPNE
LYPNEVYCVDPLGYIIGFTACDEPLTLVPPLQKSHPKPGLVSNLMSKSGSQSRNIEETKA
VRRNIAVMTSGGDSQGMNAAVRAVVRATIFHGSKAFAVQEGYAGLVKGGPEYIKEMKWQD
VRGFLSEGGTNIGTARCMEFKERWGRLKGCKNLIDAGIDGLIVCGGDGSLTGADLFRHEW
PSLIQELKDKGEITNEQFERHKHLYICGMVGSIDNDMAMTDATIGGYSALERICRAIDYI
DATANSHSRAFVVEVMGRHCGWLALMAGIATSADYIFIPEKPASSKDWQDQMCDIVGKHR
AQGKRKTIVIVAEGAITSDLKPITSDEVKDVLVDRLGLDTRITVLGHVQRGGTAVAFDRT
LATLQGVEAVKAILELTPDVPSPLIAIDENKICRRPLVEAVRITKSVASAIEAKDFEKAM
SLRDHEFKEHLANFMAMNTANHEKPTLPREKRKKIAIINIGAPAGGMNSAVYAMATYCMS
RGHTPYAIHNGFAGLSRHESVKSIEWIDIEGWNSIGGSEIGTNRQTPEETDIGMIAHYFE
KYQFDGLIIVGGFEAFVSLEQLERSRAMYPSFRIPMVLIPATISNNVPGTEYSLGADTCL
NSLMEYCDIVKQSASATRGTAFIIDVQGGNSGYIATFASLISGAQASYVPEEGISLQQLE
MDINSLREAFAVEQGMTKSGKLIIKSSNASKVLTPHTLADIFNDECHGDFDTKTAIPGHV
QQGGLPSPIDRSRGDRFAIRAVQFIEDHCDVLAPYRYELDFPIDDKKILNTAAVLGIKSS
RLRFTSIRHLFDFETELGRRMPKTIYWNTIRDISDQLVGRTRLDKP
NT seq 2841 nt NT seq  +upstreamnt  +downstreamnt
atgatttcaattgttaatggtacttccacactttcattggttgctggtagtgtggaaact
ttaaatcaagcaatcaacttctataccaacatacttgggttgtccgtccattcggaacaa
aatgactggacatatttatcaaatgacgacaataaaatgattgtcaagatacaattagac
accaaatctgggttatcgcttgaccaaatcaatgatagaagaacagaaattattgccaaa
ttgaatatcactgattggagatcattggacaccaccagtgttttgaaagttcaaaattta
gttgctttgattgaaactttaaccacattcaactacactttgcaaatcacccctaacgaa
ttgtaccctaatgaagtttattgcgtggacccattgggttatattattgggtttacagct
tgtgatgaaccattaacccttgttccaccattgcaaaaatcccaccctaagccagggttg
gtttccaacttgatgtcaaaatctggctctcaatcaagaaatattgaagagaccaaagca
gtgagaagaaacatcgctgtcatgacttcaggtggggattctcaaggtatgaatgctgcc
gttagagctgtcgttagagccacgattttccatggaagcaaggcctttgctgtccaagaa
ggttatgctggtttggtcaaaggtggtcctgaatacattaaggaaatgaaatggcaagac
gtcagaggttttctttcagaagggggtaccaatattggtactgccagatgcatggagttt
aaggaacgttggggtagattgaaaggatgtaaaaacttgattgatgctggaattgacggg
ttgatcgtgtgtggtggtgatggttctttaactggtgctgatttattcagacacgaatgg
ccatcattaattcaagaattgaaagataaaggtgaaatcaccaatgaacaatttgaaaga
cacaaacacttgtacatttgtggtatggtgggttccattgataatgatatggccatgact
gatgctacaattggtggctactctgcattagagagaatttgtcgtgccatcgattacatt
gatgctactgctaactcccattcgcgtgcctttgttgttgaggtcatgggtagacattgt
ggttggttagccttgatggccggtattgctaccagtgctgattatatttttattccagag
aaacctgcctcctcaaaagattggcaagatcaaatgtgcgacattgttggtaaacataga
gctcaaggtaaaagaaagaccattgttattgttgctgaaggtgcaattacctccgatttg
aaaccaatcacatctgacgaagttaaagatgttttggtcgacagattagggttggacacc
agaatcactgtgttgggacatgttcaaagaggtggtactgctgtagcctttgatagaact
ttagccactttgcaaggggttgaagcagtgaaagccattttggaattaactcctgatgtt
ccatctccattaattgccattgacgaaaataagatttgtcgccgtccattggttgaagca
gttagaatcaccaaatccgtggcttcagctatcgaagctaaagattttgaaaaggcaatg
tctttaagggatcacgaattcaaagagcatttggctaatttcatggccatgaacactgcc
aaccatgaaaagccaactttacctcgtgaaaaacgtaagaagattgccattatcaacatc
ggtgctcccgctggtggtatgaattctgctgtttatgctatggccacttactgtatgtct
cgtggtcacaccccatatgctatccacaatgggtttgctggtttatcaagacacgagtca
gtgaaactgattgaatggattgacatcgaagggtggaacagtattggggggtctgaaatt
ggtacgaacagacaaacacctgaagaaactgacattggtatgattgcccattattttgaa
aaataccagtttgacgggttaattattgttggaggttttgaagcatttgtttcgttagag
caattggaaagatcaagagctatgtatccatcgttcagaattcctatggttttaatccct
gccaccatttcaaataatgttcctggtaccgaatattctttaggggctgatacctgtttg
aattcgttaatggaatattgtgacattgtcaagcaatcagcttcagctaccagaggtaca
gcatttattattgatgttcaaggaggtaattccggatacattgccacatttgcctcatta
atcagtggagcacaagcatcctatgttccagaagaaggtatttcattacagcaattggaa
atggatatcaattcattgagagaagcatttgccgtggaacaaggaatgacaaagagtggt
aaattgatcatcaagtcgagtaatgcatccaaagtactaaccccacacacattggctgac
atattcaacgatgaatgtcacggtgactttgacactaagacagctattccgggacacgtc
caacaaggtggattaccttcaccaatagatagaagcagaggtgatagatttgccattaga
gctgttcaatttattgaagaccactgtgatgttttagctccatacagatacgaattggac
ttcccaattgatgacaagaaaatcttaaacacagcggctgtattaggtatcaagtcttca
cgtttgagattcacctctatcagacatttgtttgatttcgaaactgaattgggtagaaga
atgccaaagaccatctactggaatacaattagagatatttctgatcaattagttggaaga
acaagacttgataagccataa

DBGET integrated database retrieval system