KEGG   Candida albicans: CaO19.6584Help
Entry
CaO19.6584        CDS       T00189                                 

Gene name
PRT1
Definition
translation initiation factor eIF3 subunit
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
cal  Candida albicans
Pathway
RNA transport
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 739 aa AA seqDB search
MSINEEDYLQLEKEIKLDDIDFSDLEEKYEVNIGLDNYIIVDGAPIAPEAKVPVLIKVLR
KLFSQVGEIVEGDEGIYMPLENGKSKGYLFIQFKSTESADLAIKKLHGKKLDQNHRLLVN
KLSDMEKYGVDGAVNEEFIEPEIEPFQSHGYLKSWLQDEQGRDQMVLHFSETVGVYWNKK
SADPEPVIEPRKGFTSKYAKFSPKGTYLFSIHPQGIQSWGGANFNSIKRFFHQQVRLVDF
SPNEKFMVTLSPIPISLPDSTVDRAQFPFGPESEGHKLVIWNMITGEPVRTFALPPHLEG
QKEMPWPLVKWSYDDKYCARQGPDALAIYETESNFQLLDKKLVKVDGIQDFEWAPAGVKL
HNSKAVDGKHVLSYWTPESTNQTARVALMQIPSREILRTVNLFQVSDCKMHWQSNGKLLC
VKVDRHTKSGKTIFSNLEFFKTNERDIPVEKLELKDVVVNFAWEPNTERFITISRLDDGN
PNPAIPKNTISFYAPEVTKGGVNHNSKKKGGAAIAAAVAAAAINNQSSTKYKAYTKIENK
HSNTIFWSPKGRYVVVATISRTSGELEFFDVSFDDETNKKSLPANVKLLKTDKFSGMTNI
SWDPSGRFVAAWSTSWLHAIENGYRLYEFTGNLLRDDSIDQFKDFVWRPRPPSLLTNSDK
KKVRSNLREYSAQFEEADAMEADAAVKEIILARRKALEEWRKYRAKHISKQGNSKNEVQA
EIIEEIKEEIIEEKEEIVE
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atgtcaattaacgaggaagattatcttcaacttgaaaaggaaatcaaattagatgacatt
gatttttctgatttagaagaaaaatatgaagttaatattggattagataattatattatt
gttgatggagctccaattgcaccagaagctaaagttccagttttaattaaagttttacgg
aaattattttctcaagttggggaaattgttgaaggagatgaaggaatttatatgccatta
gaaaatggtaaatctaaaggatatcttttcattcaatttaaatcaacagaactggccgat
ttagccattaaaaaattacatgggaaaaaattggatcaaaatcatcgattattagttaat
aaattatctgatatggaaaaatatggtgttgatggagctgttaatgaagaattcattgaa
ccagaaattgaaccatttcaaagtcatggatatttgaaatcttggttacaagatgaacaa
ggtagagatcaaatggttttacattttagtgaaacggtaggagtttattggaataaaaaa
tctgctgatccagaaccagtcattgaaccaagaaaagggtttacttctaaatatgctaaa
ttttcaccaaaagggacatatttattttcaattcatcctcaaggtattcaatcatggggt
ggagctaatttcaatagtattaaaagatttttccatcaacaagttagattagttgatttt
tctccaaatgaaaagtttatggttactttatcacctattccaattagtttacccgattca
acggttgatcgtgctcaattcccatttggtcctgaaagtgaaggtcataaattggtcatt
tggaatatgattactggtgaaccagtcagaacatttgctttaccacctcatttagaagga
caaaaggaaatgccgtggccattagttaaatggtcttatgatgataaatattgtgctcgt
caaggaccagatgctttagccatttatgaaactgaatccaatttccaattattagataaa
aaattggttaaagttgatggtattcaagatttcgaatgggctccagctggggttaaactt
cataatagtaaagctgttgatggtaaacatgttttgagttattggactccagaaagtact
aatcaaaccgctagagttgccttgatgcaaattccttcgagagaaattttacgtactgtc
aatttattccaagttagtgattgtaaaatgcattggcaatctaatgggaaattattatgt
gttaaagttgatcgtcatacaaaatcaggtaaaactattttctccaatttggaatttttc
aaaactaatgaaagagatatcccagttgaaaaattagaattaaaagatgtggtggttaat
tttgcttgggaaccaaatactgaaagatttattactattagtagattagatgatggtaat
ccgaatcctgctattccaaaaaataccatttcattctatgcaccagaagttaccaaaggt
ggagttaatcacaatctgaaaaagaaaggtggtgccgccattgctgctgctgttgctgct
gctgctattaataatcaactgtcaactaaatataaggcatacaccaaaatcgaaaacaaa
cactcaaacactattttctggtcaccaaagggaagatatgttgttgttgctactatttca
agaacttctggtgaattggaatttttcgatgtttcatttgatgatgaaactaataaaaaa
tcattacctgctaatgtcaaattattaaagaccgataaattttctggaatgaccaatatt
tcttgggatccatcaggtagatttgttgctgcttggtcaacttcttggttacatgccatt
gaaaatggttatagactttatgaattcactggtaatttattaagagatgattcaattgat
caattcaaagattttgtttggagaccaagaccaccatctttattgaccaatagtgataaa
aagaaggtcagatccaatttacgtgaatatagtgcacaatttgaagaagctgatgctatg
gaagctgatgctgctgttaaagaaatcattttggctcgtagaaaggctttggaagaatgg
agaaagtaccgtgccaaacatattagtaaacaaggtaattccaagaacgaagttcaagca
gaaattattgaagaaattaaagaagagattattgaagaaaaagaagaaattgttgaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system