KEGG   Candida albicans: CaO19.6594Help
Entry
CaO19.6594        CDS       T00189                                 

Gene name
PLB4
Definition
phospholipase B4; one of five likely phospholipase B-like genes; similar to torulaspora delbruekkii PLB and to S. cerevisiae PLB1 (YMR008C)
Orthology
K13333  
lysophospholipase [EC:3.1.1.5]
Organism
cal  Candida albicans
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:cal00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    CaO19.6594 (PLB4)
Enzymes [BR:cal01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     CaO19.6594 (PLB4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 632 aa AA seqDB search
MELLNIIVVLFLSIYTNPIIAWSPTDSYAPGEIQCPSNSSLTRNADSLSPQEQEWLKGRS
PIANENLISFLNSANMTDFDPESFINGLNRSIKIGLSFSGGGYRAMLNGAGQLAALDNRT
RGGFESGLGGLLQASTYLVGLSGGNWMVGTIAYNNFTSVQHILDQDSIWDLSHSIMNPGG
WNIKKTYNYYKNISDALDDKRNAGFDVSITDTWGRALSHQFFPGLDDGGDALTWSTLQDV
DVFKNYEMPFPIVVADGRTPGTYVISGNSTVFEFNPFEMGSWDPAVYQFSQVKYLGTEVK
DGKPSSNGKCIGGFDNAGFIMGTSSSLFNQFILQINTTSLSSTIKSLLTSILQDLSNDDN
DIAVYKPNPFKDSDVAGSKSIASNDTLYLCDGGEDLQNIPLYPLLQEQRQVDVIFAYDNS
ADTNQYWPNGASMVASYQRQFGNQSNGTSFPYVPDVATFVNSNLTAKPTFFGCDAKNLTS
LTTTQNKTSVYDIPLLVYTANRPFSYWSNTSTFQMKYETKERNAIIQNGFEVATRMNLTL
DNEWKACVGCAIIRRQQERQGLEQSDQCKKCFEKYCWDGKLTTNADAININFTTEGTTND
TESMKVNSGVLTSVSWSLWAMMLAALSVFILG
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atggaattattaaatatcatagtggtattgtttctatcaatttatactaatccaataata
gcttggtccccaactgattcttatgcaccaggagaaattcaatgtccttcaaattcatca
ttaactagaaatgccgattcactttcacctcaagaacaagaatggttaaaaggtagaagt
ccaattgccaatgaaaatttaatttcatttttaaatagtgctaatatgacagattttgat
ccagaatcatttattaatggattaaatcgttcgattaaaattggtctttcattttctggt
ggtggatatcgtgccatgttgaatggagctggacaattagccgcattagataatagaact
agaggtggttttgaatcaggattaggtgggttattacaagcatcgacttatttagttgga
ttatcaggagggaattggatggtaggtaccattgcttataataattttacttcagtacaa
catatattagatcaagattcaatttgggatttaagtcattcaattatgaatcctggtggt
tggaatattaaaaaaacttataattattataaaaatatttctgatgccttagatgataaa
agaaatgctggatttgatgtttcaattactgatacttggggtcgagctttatctcatcaa
tttttccctggattagatgatggtggtgatgcattaacttggtcaacattacaagatgtc
gatgttttcaaaaattatgaaatgccattcccaattgttgttgctgatggtagaactcct
gggacttatgttattagtggcaattctactgttttcgaatttaatccatttgaaatggga
tcatgggatcctgcagtttatcaattttctcaagtcaaatatcttggtaccgaagttaaa
gatggtaaaccatcactgaatggtaaatgtattggtgggtttgataatgcgggatttatc
atggggacttcttcttcattgtttaatcaattcattttacaaattaatactacatcatta
tcatcaacgattaaatcacttcttacatcgattttacaagatctttctaatgatgataat
gatattgctgtttataagcctaatccatttaaagatagtgatgttgctggatcgaaatcc
attgcttctaatgatactttatatctttgtgatggtggtgaagatcttcaaaatatccct
ctttatccattattacaagaacaacgtcaagttgatgttattttcgcttatgataattcg
gctgatacaaaccaatattggcctaatggtgcctccatggtagcatcataccaaagacaa
tttgggaatcaaagtaatggtactagtttcccatatgtacctgatgtggccacatttgtt
aattctaatttaactgccaaaccaacattttttggttgtgatgccaaaaatttaacttca
ttaacaacaactcaaaataaaactagtgtttatgatattccacttttagtttatactgct
aatcgtccattttcttattggtccaatacttcaacgttccaaatgaaatatgaaactaaa
gaacgtaatgccattattcaaaatggatttgaagtggcaacaagaatgaatttaacttta
gataatgaatggaaagcttgtgttggttgtgccattattagaagacaacaagaaagacaa
ggtcttgaacaaagtgatcaatgtaaaaaatgttttgaaaaatattgttgggatggtaaa
ctaacaactaatgctgatgctatcaatattaattttactactgaaggtactactaatgat
accgaatcaatgaaagttaatagtggggtgttaacaagtgtaagttggtcattatgggcc
atgatgttagcagctttaagtgtatttatccttggataa

DBGET integrated database retrieval system