KEGG   Candida albicans: CaO19.6673Help
Entry
CaO19.6673        CDS       T00189                                 

Gene name
HEX1
Definition
beta-N-acetylglucosaminidase whose expression is induced when cells are grown in presence of GlcNAc
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
cal  Candida albicans
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cal00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CaO19.6673 (HEX1)
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    CaO19.6673 (HEX1)
   00603 Glycosphingolipid biosynthesis - globo series
    CaO19.6673 (HEX1)
   00604 Glycosphingolipid biosynthesis - ganglio series
    CaO19.6673 (HEX1)
   00511 Other glycan degradation
    CaO19.6673 (HEX1)
Enzymes [BR:cal01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     CaO19.6673 (HEX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 562 aa AA seqDB search
MVLDKMIIFHLLLWLCNVVVHAAKVEILPAPQSVTWENDTAIIINPRLLQANTSCPLLED
AFVRTVSAIEKSKWHPFPIDDFNTANGKNIKTSLVHIQVDDATVDLQLGVNESYTLKINT
DGINIHAATTWGALHGLVSLQQLIIHTSEDKYVVPSSVTISDFPNFKHRGLMIDSGRNFL
TVDSILEQIDIMALSKMNSLHWHLADSQSWPVALESYPHMIKDAYSNDEVYSKNDLKYIV
DYARARGVRVIPEIDMPGHARAGWKQVDPTIVECADAFWTDAAVEPPPGQLNIESEKTYE
VISNVYNELSDIFIDDVFHVGNDELQEKCYSAQLSPNNTVTDLLKRYLKKALPIFNKVNH
RKLTMWDDVLLSDVSADKIPSNITLQVWHEISGVKNLTSRGYDVVVSSSDFLYLDCGNAG
WVTNDPRYVETPENVDFNTGQGGSWCGPYKSYQRIYNFDFTANLTETEKNHVLGAEAALW
SEQVDSTVLTTKIWPRTAALAELTWSGNKDSNGHHRGYEFTQRILNFREYLVKLGYGVSP
LVPKYCLLNPHACDLYKNPPVY
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atggtgttagataaaatgattatctttcatttgcttctttggttgtgcaatgtggttgtc
cacgctgccaaggttgaaatactcccagctccacagtcagtaacctgggaaaatgacaca
gcaattattataaatccaagattgttacaagccaacacctcctgtccacttttagaagat
gcatttgttagaactgtctcggcaatagaaaagctgaaatggcaccctttccccattgat
gactttaacactgcaaatggaaaaaatattaaaacatctttagtacatatccaagtagac
gatgctacagtcgacttgcaacttggagttaatgaatcttacaccttgaaaattaataca
gatggaattaatatccatgcagcaaccacctggggagcattacatggcttggttagtctc
caacaattgataatccatacctccgaggacaagtatgttgtacccctgtcggtgacaatt
tctgattttcccaatttcaaacatagaggattgatgattgattcaggtcggaacttttta
acagtggactcaatacttgaacaaatagatattatggccttgtcaaaaatgaactcctta
cattggcatttggcggattcacaaagttggcctgtggcattagaaagttacccacacatg
ataaaagacgcatacagtaatgatgaagtttattccaagaacgacttgaagtatattgtt
gattatgctcgtgcaagaggtgtgcgcgtgattccagaaattgacatgcctggtcatgct
agagctggatggaaacaagtcgacccaacaatagttgaatgtgctgatgcattttggaca
gatgccgctgttgaaccaccaccaggacaattgaacatcgagtcagagaaaacctatgag
gtaatttctaatgtctacaatgagttgtcggatattttcattgatgatgttttccacgtt
ggaaatgatgaattacaagaaaaatgctattcggctcaacttctgccaaataacacagtt
acagacttgttaaagcgatacttaaagaaagctttgccaatttttaataaggtcaatcac
cggaaactaaccatgtgggacgatgttttactatctgacgtatcagcagacaagatccct
agcaacatcactttgcaagtttggcatgagattagtggagtcaaaaacttgacttccagg
ggatatgatgttgtagtgtcgctgtctgactttttgtaccttgattgtggtaacgctgga
tgggttacaaacgatcctcgatatgttgaaaccccagaaaacgttgactttaacacaggt
caaggaggaagttggtgtggaccttataagtcttatcaacgaatttacaactttgatttc
actgctaatttgacagaaacagaaaaaaaccatgttttaggtgctgaagctgctttatgg
tcggagcaagttgattctactgtcttgactacaaagatatggccacgtactgcagcactt
gctgaattgacttggagcgggaacaaggattccaacggacaccacagagggtatgaattc
actcaaagaatattaaacttcagggagtatttagtcaaattaggatacggggtttctcct
ttggtgccaaaatactgtttgctcaatccacacgcttgtgatttgtacaaaaatccacca
gtttattga

DBGET integrated database retrieval system