KEGG   Candida albicans: CaO19.6673Help
Entry
CaO19.6673        CDS       T00189                                 

Gene name
HEX1
Definition
beta-N-acetylglucosaminidase whose expression is induced when cells are grown in presence of GlcNAc
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
cal  Candida albicans
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:cal00520]
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan degradation [PATH:cal00531]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:cal00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 562 aa AA seqDB search
MVLDKMIIFHLLLWLCNVVVHAAKVEILPAPQSVTWENDTAIIINPRLLQANTSCPLLED
AFVRTVSAIEKSKWHPFPIDDFNTANGKNIKTSLVHIQVDDATVDLQLGVNESYTLKINT
DGINIHAATTWGALHGLVSLQQLIIHTSEDKYVVPSSVTISDFPNFKHRGLMIDSGRNFL
TVDSILEQIDIMALSKMNSLHWHLADSQSWPVALESYPHMIKDAYSNDEVYSKNDLKYIV
DYARARGVRVIPEIDMPGHARAGWKQVDPTIVECADAFWTDAAVEPPPGQLNIESEKTYE
VISNVYNELSDIFIDDVFHVGNDELQEKCYSAQLSPNNTVTDLLKRYLKKALPIFNKVNH
RKLTMWDDVLLSDVSADKIPSNITLQVWHEISGVKNLTSRGYDVVVSSSDFLYLDCGNAG
WVTNDPRYVETPENVDFNTGQGGSWCGPYKSYQRIYNFDFTANLTETEKNHVLGAEAALW
SEQVDSTVLTTKIWPRTAALAELTWSGNKDSNGHHRGYEFTQRILNFREYLVKLGYGVSP
LVPKYCLLNPHACDLYKNPPVY
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atggtgttagataaaatgattatctttcatttgcttctttggttgtgcaatgtggttgtc
cacgctgccaaggttgaaatactcccagctccacagtcagtaacctgggaaaatgacaca
gcaattattataaatccaagattgttacaagccaacacctcctgtccacttttagaagat
gcatttgttagaactgtctcggcaatagaaaagctgaaatggcaccctttccccattgat
gactttaacactgcaaatggaaaaaatattaaaacatctttagtacatatccaagtagac
gatgctacagtcgacttgcaacttggagttaatgaatcttacaccttgaaaattaataca
gatggaattaatatccatgcagcaaccacctggggagcattacatggcttggttagtctc
caacaattgataatccatacctccgaggacaagtatgttgtacccctgtcggtgacaatt
tctgattttcccaatttcaaacatagaggattgatgattgattcaggtcggaacttttta
acagtggactcaatacttgaacaaatagatattatggccttgtcaaaaatgaactcctta
cattggcatttggcggattcacaaagttggcctgtggcattagaaagttacccacacatg
ataaaagacgcatacagtaatgatgaagtttattccaagaacgacttgaagtatattgtt
gattatgctcgtgcaagaggtgtgcgcgtgattccagaaattgacatgcctggtcatgct
agagctggatggaaacaagtcgacccaacaatagttgaatgtgctgatgcattttggaca
gatgccgctgttgaaccaccaccaggacaattgaacatcgagtcagagaaaacctatgag
gtaatttctaatgtctacaatgagttgtcggatattttcattgatgatgttttccacgtt
ggaaatgatgaattacaagaaaaatgctattcggctcaacttctgccaaataacacagtt
acagacttgttaaagcgatacttaaagaaagctttgccaatttttaataaggtcaatcac
cggaaactaaccatgtgggacgatgttttactatctgacgtatcagcagacaagatccct
agcaacatcactttgcaagtttggcatgagattagtggagtcaaaaacttgacttccagg
ggatatgatgttgtagtgtcgctgtctgactttttgtaccttgattgtggtaacgctgga
tgggttacaaacgatcctcgatatgttgaaaccccagaaaacgttgactttaacacaggt
caaggaggaagttggtgtggaccttataagtcttatcaacgaatttacaactttgatttc
actgctaatttgacagaaacagaaaaaaaccatgttttaggtgctgaagctgctttatgg
tcggagcaagttgattctactgtcttgactacaaagatatggccacgtactgcagcactt
gctgaattgacttggagcgggaacaaggattccaacggacaccacagagggtatgaattc
actcaaagaatattaaacttcagggagtatttagtcaaattaggatacggggtttctcct
ttggtgccaaaatactgtttgctcaatccacacgcttgtgatttgtacaaaaatccacca
gtttattga

DBGET integrated database retrieval system