KEGG   Candida albicans: CaO19.6745Help
Entry
CaO19.6745        CDS       T00189                                 

Gene name
TPI1
Definition
similar to S. cerevisiae TPI1 (YDR050C) triose phosphate isomerase; gluconeogenesis
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cal  Candida albicans
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cal00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CaO19.6745 (TPI1)
   01230 Biosynthesis of amino acids
    CaO19.6745 (TPI1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CaO19.6745 (TPI1)
   00051 Fructose and mannose metabolism
    CaO19.6745 (TPI1)
   00562 Inositol phosphate metabolism
    CaO19.6745 (TPI1)
Enzymes [BR:cal01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CaO19.6745 (TPI1)
Exosome [BR:cal04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CaO19.6745 (TPI1)
  Exosomal proteins of bladder cancer cells
   CaO19.6745 (TPI1)
  Exosomal proteins of melanoma cells
   CaO19.6745 (TPI1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 248 aa AA seqDB search
MARQFFVGGNFKANGTKQQITSIIDNLNKADLPKDVEVVICPPALYLGLAVEQNKQPTVA
IGAQNVFDKSCGAFTGETCASQILDVGASWTLTGHSERRTIIKESDEFIAEKTKFALDTG
VKVILCIGETLEERKGGVTLDVCARQLDAVSKIVSDWSNIVVAYEPVWAIGTGLAATPED
AEETHKGIRAHLAKSIGAEQAEKTRILYGGSVNGKNAKDFKDKANVDGFLVGGASLKPEF
VDIIKSRL
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggctcgtcaatttttcgtaggtggcaacttcaaagctaacggtaccaaacaacaaatc
acttcaatcatcgacaacttgaacaaggctgatttaccaaaggatgtcgaagttgtcatt
tgtccaccagccctttaccttggtttagctgttgagcaaaacaaacaaccaactgttgcc
attggtgctcaaaatgtttttgacaagtcatgtggtgctttcactggtgaaacctgtgct
tctcaaatcttggatgttggtgccagctggactttaactggtcacagtgaaagaagaacc
attatcaaagaatccgatgaattcattgctgaaaaaaccaagtttgccttggacactggt
gtcaaagttattttatgtattggtgaaaccttagaggaaagaaaaggtggtgtcactttg
gatgtttgtgccagacaattggatgctgtttccaagattgtttctgattggtcaaacatt
gttgttgcttacgaacctgtttgggcaattggtactggtttagccgctaccccagaagat
gctgaagaaacccacaaaggtattagagctcatttggccaagagcattggtgccgaacaa
gctgaaaaaaccagaatcttgtatggtggttcagtcaacggtaagaacgctaaggatttc
aaagacaaagcaaatgttgatggtttcttagtcggtggtgcttcattaaaaccagaattt
gttgatatcatcaaatctagattataa

DBGET integrated database retrieval system