KEGG   Candida albicans: CaO19.6801Help
Entry
CaO19.6801        CDS       T00189                                 

Gene name
RPD31
Definition
one of two distinct genes with strong similarity to S. cerevisiae RPD3 (YNL330C) SIN3 histone deacetylase complex component
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
cal  Candida albicans
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 577 aa AA seqDB search
MYTELPFDELKVDPNQKKRIAYFYDADIGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKKM
EIYRAKPATKQEMCQFHTDEYIDFISRVNPDNLDLFTKEQIKFNVGDDCPVFDGLFEYCG
ISGGGSMEGAARLNRGKCDIAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHPRVL
YIDIDVHHGDGVEEAFYTTDRVMTCSFHKYGEFFPGTGELRDIGVGKGKYHSVNVPLRDG
IDDATYKSVFEPVISKIIEWYQPSAIVLQCGGDSLSGDRLGCFNLSMNGHANCINYVKSF
NIPMMVVGGGGYTMRNVARTWAYESGLLNNVKLPDELPYNEYYEYYGPDYKLDVRSSNMF
NQNSPEFLDKILTNIIANLENTKHAPSVQMNEVPNDPEDLGDVEEDTAMAIDTKGGSEMS
RDAQIQPDNEFYEDDEKDKGEKAIIDNKHEDQDSMQVDKSEEPVVEQKDKPQDENNVTGD
NIEEDQPQEVNPIEEQPSVEKSVVVVEDKLEEVKPVEQKVEEPKEVVDKPEDKHEDKPAE
TLTETTTESKPEDQPMEDAAKLTEEELKEIEELNKSS
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atgtatactgaacttccatttgatgaattgaaagttgatccaaaccaaaagaaacgtatt
gcttatttctatgatgctgatattgggaattatgcttatggggctggtcatcccatgaaa
cctcatcgtataagaatggcccattcattaattatgaattatggattatataaaaaaatg
gaaatttatcgagctaaaccagcaacaaaacaagaaatgtgtcaatttcatactgatgaa
tatattgattttattagtcgagttaacccagataatttagatttatttactaaagaacaa
attaaatttaatgttggtgatgattgtcccgtttttgatggattatttgagtattgtggt
attagtggtggtggatcaatggaaggtgccgccagattgaatcgtggtaaatgtgatatt
gccatcaattacgctggtgggttacatcatgcgaaaaaatctgaagctagtggattttgt
tatttgaatgatattgtgttggggatcattgaattattacgttaccatcccagagtttta
tatattgatattgatgttcatcatggtgatggtgttgaagaagcattttatactactgat
agagtaatgacttgttcttttcataaatatggtgagtttttccctggcacaggtgaatta
agagatattggggttggaaaggggaaataccattcggttaacgttccattacgtgatggg
attgatgatgctacttataaatcagtgtttgaaccagtaatatcgaaaatcattgaatgg
tatcaaccttcagccattgttttacaatgtggaggtgattccttgagtggtgatagatta
ggttgttttaatttatcaatgaatggtcatgctaattgtatcaattatgttaaatcattt
aatattccaatgatggtagttggtggaggtggttatactatgagaaatgtggctcgtact
tgggcgtatgaactgggattattaaataatgtcaaattacccgatgaattgccttataat
gaatattatgaatattatggtcctgattataaattggatgttcgatcttctaatatgttt
aatcagaattctccagaatttttagataaaattttgactaatattattgccaatttggaa
aatacaaagcatgcaccttcagtacaaatgaatgaagtccctaatgatcctgaagatttg
ggcgatgttgaagaagataccgctatggcaattgacacaaagggaggctccgaaatgagt
cgagatgctcaaatacaaccagataatgagttttatgaagatgatgaaaaagataagggc
gagaaagctataattgataataaacatgaagatcaagactctatgcaagttgataaaagt
gaagaacctgtggttgaacaaaaagataaaccacaagacgagaataacgttaccggtgat
aatatagaagaagatcaaccgcaagaagtgaacccaattgaagagcaaccttcagtggaa
aaactggtagtggtggtggaagacaaactagaagaagtgaaacctgttgaacagaaagta
gaggaaccaaaagaagtggttgataaaccagaagacaaacatgaagataaaccagcagaa
acccttacagagaccaccacagaactgaaaccagaggatcaaccaatggaagatgctgca
aagttgactgaagaagaattgaaagaaattgaagaactaaataaaagttcataa

DBGET integrated database retrieval system