KEGG   Candida albicans: CaO19.6812Help
Entry
CaO19.6812        CDS       T00189                                 

Gene name
PMT2
Definition
similar to dolichyl-P-mannose:protein mannosyltransferase involved in mannosylation of serine and threonine residues
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
cal  Candida albicans
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:cal00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    CaO19.6812 (PMT2)
Enzymes [BR:cal01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose---protein mannosyltransferase
     CaO19.6812 (PMT2)
Glycosyltransferases [BR:cal01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   CaO19.6812 (PMT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 769 aa AA seqDB search
MSTSVEPNETEALLRKQNDLSTTASIEEKYPHQQGEAAEDDDDTLKRTQYDEAKETAESL
KQVESILAPIVFTALSFFVRFYRISVNDHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKM
LVGLSGYLAGYNGSWDFPSGEKYPDYIDYTKMRLFNATFSALCVPLAYFTGKEVGFSMFT
TWLFTLMVALESSYVTLGKFILLDSMLLFFTVATVFCFSRFNNFNNKSQEFSRKWWKWIL
LTGVSIGCTCSVKMVGLFVTTLVGIYTVVDLWNKLSDKSISWTKYIQHWFARIVALILVP
IFIFMLSFKVHFDLLYKSGTGDANMSSLFQANLAGSDVGGGPREVSMFHSVITLKNQGLS
GGLLHSHVQTFPEGSKQQQVTTYGHKDSNNNWIFQRARGQPYYDTSGNTTDIEYIFDGMH
VRLMHPQTGRNLHTHDIPAPVSKSEYEVACYGNLTIGDPKDNWTVEIMEQASDEDKMRLH
PLTSSFRLKNEVMNCYLGVTGTTLPQWGFRQGEVVCYKNPFKKDKRTWWNIENNRNAVLP
PAPEDFKLPKTKFIRDFIQLNLAMMATNNALVPDTEKQDDLASSFWQWPTLNVGIRMCGW
GPENPKYYMIGSPATTWTSTVGVILFAFIVLYYLIRWQRQYVDFPSTNPHKLKLFLMGGI
YPMFGWGLHFLPFAIMGRVTYVHHYVPALYFAMLVFCYEVESFSSRLNKPNASPVSKLLY
LAIYIGLLSLVAGTFWYFRYLSWGMEGPKEDWKHLKLLESWRVSDDQYT
NT seq 2310 nt NT seq  +upstreamnt  +downstreamnt
atgtctacttctgttgaacccaatgaaacagaagctttgttgagaaagcagaatgatctt
tccacaactgcctcaattgaagaaaaatatcctcaccaacaaggagaggctgcagaagac
gatgacgacactcttaaaagaacccaatatgatgaagctaaagaaaccgctgaatcttta
aaacaagttgaatcgatattagcacctattgttttcactgcattgtcatttttcgtgaga
ttttatcgtatttcagtgaatgaccatgttgtttgggatgaagctcattttggtaaattt
ggatcctattatttacgacacgaattttatcatgatgttcatcctccattgggtaaaatg
ttagttggtttatctggttatttggctggatacaatggatcttgggatttcccaagtggt
gaaaaataccctgattatattgattatactaaaatgagattgtttaatgccactttctct
gccttgtgtgtaccattggcttatttcactgggaaagaagttggattttccatgtttact
acttggttatttactttgatggtggctcttgaatcaagttatgtcactttaggtaaattc
attttgttggattcaatgttgttattcttcaccgttgctactgttttctgtttttcacgt
ttcaacaattttaacaataaatcacaagaattttctagaaaatggtggaaatggattctt
ttaactggtgtttccattggttgtacttgttctgtaaaaatggttggattgtttgttacc
acattggtcgggatttacactgttgttgacctttggaataaattgagtgataaatctatt
tcatggacaaaatacattcaacattggtttgctagaattgttgctttgattcttgtccca
attttcattttcatgctttcatttaaagttcattttgatttgttgtataaatcgggtact
ggtgatgccaatatgtcatcacttttccaagctaatttggctggttccgatgttggtggt
ggcccacgtgaagtatccatgttccactcggttatcactttaaagaatcaaggtttaagt
ggtggccttttacactcccacgttcaaacattcccagaaggttcaaaacaacaacaagtt
actacttatggtcacaaagattcaaacaacaattggattttccaaagagctagaggacaa
ccttattatgatacttctggtaacaccactgacattgaatatatttttgacggtatgcat
gtaagattgatgcatccacaaactggtagaaacttacatactcatgatattccagctcca
gtgtctaaatctgaatatgaagttgcatgttatggtaatttgactattggtgatcctaaa
gataattggactgttgaaattatggaacaagcaagtgatgaagataaaatgagattacat
cctttgacttcgtcatttagattgaagaatgaagtgatgaattgttatttgggggtcact
ggtactacattacctcaatgggggttcagacaaggtgaagttgtttgttacaagaaccca
tttaaaaaagacaagagaacttggtggaatattgaaaacaatcgtaatgcagttttacca
ccagctccagaagatttcaaattacctaaaactaagtttattcgtgatttcattcaattg
aatttggccatgatggctactaacaatgctttagttccagacactgaaaagcaagatgat
ttggcttcatcattttggcaatggccaacattgaatgttggtattagaatgtgtggatgg
ggaccagaaaatcctaaatattatatgattggttcaccagcaactacttggacttctact
gttggtgttatattatttgctttcattgttttgtattatttgattagatggcaaagacaa
tacgttgatttcccaagtacaaatccacacaaattgaaattattccttatgggaggtatt
tatccaatgtttggatggggattacatttcttaccatttgccattatgggaagagttaca
tatgttcatcattatgttcctgcactttattttgccatgcttgttttctgttatgaagtt
gaatcattttcttcaagattaaataaacctaatgcttctccagtgctgaaattattatat
ttggccatttatattggtttactctctttagtggctggtactttctggtatttcagatat
ttgtcttggggtatggaaggaccaaaagaagattggaaacatttgaaattattggaatct
tggagagtttctgatgatcaatacacctag

DBGET integrated database retrieval system