KEGG   Candida albicans: CaO19.6844Help
Entry
CaO19.6844        CDS       T00189                                 

Gene name
ICL1
Definition
isocitrate lyase capable of functionally substituting for S. cerevisiae ICL1 (YER065C); gluconeogenesis
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
cal  Candida albicans
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:cal00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CaO19.6844 (ICL1)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CaO19.6844 (ICL1)
Enzymes [BR:cal01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     CaO19.6844 (ICL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 550 aa AA seqDB search
MPYTPIDIQKEEADFQKEVAEIKKWWSEPRWRKTKRIYSAEDIAKKRGTLKINHPSSQQA
DKLFKLLEKHDADKTVSFTFGALDPIHVAQMAKYLDSIYVSGWQCSSTASTSNEPSPDLA
DYPMDTVPNKVEHLWFAQLFHDRKQREERLTLSKEERAKTPYIDFLRPIIADADTGHGGI
TAIIKLTKMFIERGAAGIHIEDQAPGTKKCGHMAGKVLVPVQEHINRLVAIRASADIFGS
NLLAVARTDSEAATLITSTIDHRDHYFIIGATNPEAGDLAALMAEAESKGIYGNELAAIE
SEWTKKAGLKLFHEAVIDEIKNGNYSNKDALIKKFTDKVNPLSHTSHKEAKKLAKELTGK
DIYFNWDVARAREGYYRYQGGTQCAVMRGRAFAPYADLIWMESALPDYAQAKEFADGVKA
AVPDQWLAYNLSPSFNWNKAMPADEQETYIKRLGKLGYVWQFITLAGLHTTALAVDDFSN
QYSQIGMKAYGQTVQQPEIEKGVEVVKHQKWSGATYIDGLLKMVSGGVTSTAAMGQGVTE
DQFKESKAKA
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgccttacactcctattgacattcaaaaagaagaagctgacttccaaaaagaagttgct
gaaatcaaaaaatggtggtctgaaccaagatggagaaagaccaagagaatctattctgct
gaagacattgctaagaagagaggaaccttgaaaatcaaccatccatcatctcaacaagcc
gacaaattgttcaagttgttggaaaaacacgatgctgacaagactgtttctttcaccttt
ggtgctttagacccaatccacgttgctcaaatggccaagtacttggactccatttacgtt
tccggatggcaatgttcttctactgcttccacttctaacgaaccatctccagatttggct
gattatcctatggataccgtcccaaacaaggttgaacacttgtggtttgctcaattgttc
cacgacagaaaacaaagagaagaaagattgactttgtctaaagaagaaagagccaagacc
ccatacattgacttcttgagaccaatcattgctgatgctgacactggtcatggtggtatt
actgctattatcaaattaaccaagatgttcattgaaagaggtgctgctggtatccatatt
gaagatcaagctccaggtaccaagaaatgtggtcatatggctggtaaagtgttagtccca
gtccaagaacacattaacagattggttgccatcagagcctctgctgatatttttggatcc
aacttgttggccgttgccagaacagactctgaagctgccaccttgatcacctccaccatt
gatcacagagaccactactttatcattggtgccactaacccagaagccggagatttagct
gctttgatggctgaagctgaatctaaaggcatctacggtaacgaattagctgccattgag
tctgaatggaccaagaaagctggcttgaaattgttccacgaagctgttattgatgaaatc
aagaatggtaactactctaacaaagatgctttgatcaagaaattcactgacaaggttaac
ccattgtctcacacttctcacaaagaagctaagaaattggccaaggaattgactggtaaa
gatatttacttcaactgggatgttgccagagccagagaaggttactacagataccaaggt
ggtactcaatgtgccgtcatgagaggtagagcttttgctccttacgctgatttgatttgg
atggaatccgctttgccagattatgcccaagctaaagaatttgccgacggtgttaaagct
gctgtcccagatcaatggttagcttacaatttgtctccatctttcaactggaacaaggcc
atgccagctgacgaacaagaaacttacatcaagagattgggtaaattaggttacgtgtgg
caattcatcaccttggctggtttgcacaccacagcattggctgttgatgacttctctaac
caatactctcaaattggtatgaaagcttacggtcaaactgtccaacaaccagaaatcgaa
aaaggtgtggaagttgtcaaacatcaaaaatggtctggtgctacctatattgatggtttg
ttgaagatggtcagtggtggtgttacctccactgctgctatgggtcaaggtgtcactgaa
gatcaattcaaagaatccaaagccaaggcttaa

DBGET integrated database retrieval system