KEGG   Candida albicans: CaO19.689Help
Entry
CaO19.689         CDS       T00189                                 

Gene name
PLB1
Definition
phospholipase B1; first in a tandem pair; similar to torulaspora delbruekkii PLB and to S. cerevisiae PLB3 (YOL011W); one of five likely phospholipase B-like genes
Orthology
K13333  
lysophospholipase [EC:3.1.1.5]
Organism
cal  Candida albicans
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:cal00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    CaO19.689 (PLB1)
Enzymes [BR:cal01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     CaO19.689 (PLB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 605 aa AA seqDB search
MILHHLLILLIINYCVATSPTNGYAPGPVSCPSSQLIRSGSQGINPNEQSYINARYPIAK
QALSKFLHNANLQNFDVDSFLAHSNPTIGLAFSGGGYRAMLTGAGEISSLDSRTKTNTPV
LAGILQASSYIAGLSGGSWLVGSLASNNLNSVDDMLSQGLWELTHSFLSYYGIEHPIKQV
EEWVNVGNQVASKRNANFNVSLTDIYGRLLSYPLLTNTEDEGDAYLWSDVTSASNFQSHQ
MPFPILISDGRAPDTTIINLNSTVIELTPYEFGSWDPSLNEFVDTRYLGTKLDNGRPTGK
CYNGFDNAGFFMGTSSALFNEAVLSITEANIPSFLKDIIDDILVDPILKSNIDVSAYNPN
PFFKSSGSNTAISQSKNLYLVDGGEDGQNIPISPLLHRNVSAIFAFDNSNDVLNWPDGTS
LVKTYERQFSSQGNGIAFPYVPDQYTFRNLNLTSKPTFFGCDAKNLTSLTKDIYDVPLVI
YLANRPFTYWSNTSTFKLTYDDNERQGMISNGFEIATRSSGSLDDEWAACVGCAIIRREQ
ERQGIEQTEQCKRCFENYCWDGTIYKGEPLGENFSDDGLTNSATEYNSNNVAGFNDGGTS
ILKKA
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgattttgcatcatttgttaattttgcttattataaattattgtgttgctacatcacca
actaatggatatgctcctggtccggtttcttgcccaagcagtcaattgattagatctgga
tctcaggggatcaatccaaatgaacaatcatatatcaatgccagatatcctattgccaaa
caagcattgtctaagtttttacacaatgcaaacttacaaaactttgatgttgattcgttc
ttagcacactccaatccaactattggtcttgcattcagtggcggagggtatagagcaatg
ttgactggagcaggtgaaatcagtagcttggactcaagaacaaaaaccaatactccagtt
ttagcaggcattttacaagcttcgagttatattgctgggttatcaggtggatcgtggtta
gttggaagtcttgcaagtaataatttgaactctgttgatgacatgttatctcaaggtttg
tgggaactcacacactcatttcttagttactatggcattgaacatcctataaagcaagtt
gaagaatgggttaatgttggtaatcaagttgccagcaaaagaaatgcaaattttaacgtt
tctttaactgacatatatggaagactattaagttaccctttgctcacaaacacagaagac
gaaggtgatgcttatttgtggtctgatgtaacgagtgcttcaaacttccaaagccaccaa
atgccgtttccaatattgatcagtgatggtagagctccagatactaccattattaatctc
aactccactgtgattgaattaactccatacgaatttggttcatgggatcctagtttaaat
gaatttgttgacactagatatttgggaacaaaattagacaatggtcgtccaactggtaag
tgttataatggatttgacaatgctgggtttttcatgggtacttcttctgctcttttcaac
gaagcggtgttgtctatcactgaagctaacatacctagctttttaaaagatataattgat
gatattttggtagatccaattctcaagtccaacatagacgtgtctgcttacaatccaaat
ccatttttcaaaagttctggcagcaatactgctatttctcaatcaaaaaatctttattta
gttgacggtggagaagatggccaaaacattccaataagtcccttgttgcatcgtaacgta
agtgctatatttgcctttgacaattccaatgacgttttaaactggccagatgggacttcg
ttggtgaaaacttatgaacgtcaattctcatcacagggtaatggtattgctttcccatat
gttcctgatcaatacactttccgtaatttgaacttgactagcaaacctacattttttggt
tgcgatgcaaaaaacttgacttcattgacaaaggatatttatgatgttcccttggttata
tacttggcaaatcgtccattcacttactggtctaatacatcaactttcaaattaacatac
gacgataacgaaagacaaggcatgatttccaatggatttgaaattgccactagatcaagt
ggatccttggatgatgaatgggcagcatgtgttggatgcgccatcatacggagagagcaa
gaaagacaaggtattgaacagacagaacaatgtaagagatgctttgaaaactattgctgg
gatggtaccatctataagggtgagccattaggtgaaaactttagtgatgatggattaact
aatagtgctaccgaatataacctgaataatgtagctgggtttaatgacggaggaactctg
attttgaaaaaggcataa

DBGET integrated database retrieval system