KEGG   Candida albicans: CaO19.6966Help
Entry
CaO19.6966        CDS       T00189                                 

Gene name
CKI1
Definition
likely choline kinase similar to S. cerevisiae CKI1 (YLR133W)
Orthology
K00866  
choline kinase [EC:2.7.1.32]
Organism
cal  Candida albicans
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cal00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    CaO19.6966 (CKI1)
Enzymes [BR:cal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     CaO19.6966 (CKI1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 622 aa AA seqDB search
MVVEEEGVTFINNNNWSKRAKKKKISPNNLIKKFKSLSFIYTLYTSPPQFMMEISPANIK
EQSRSRSRSRTRNSTANSRSTSATRRPSLSSTHRRSLSSSSLNKLTITTTQVDQERSVPS
VQVYLDNSLPLDFFKQDIIALTKTLKISKWHKRQLTINNLSINRISGALTNAIYKIEYHD
ESQNIHLPTLLLRVYGKNVDELIDRDNELAILIKLSQKRIGPRLLGIFSNGRFEQFLDGF
ITLNKEQIRDEILSQMLGRRMKDLHYKIELDAKDYESKQPTCWNLIDKWLKIFEQELLPG
YLEVNYNLQDIFIVPFDQFKQIITKYKQWLFNKYDDKHFTNNYKFCHNDTQYGNLLLHES
FNPKDIVVSTSDTTNSSNNIIDGEVTIKSTSNKKDTNLVVIDFEYSGANFPAYDIVNHFS
EWMSDYHDPEKSYFIHQENYPNQLEQINLIKSYIEYDFQYPSSNLKTGKTPEDLINNTTN
PISIIQYEIEKLYNECIYWRATVQIFWCLWGLIQNGPLKKPLNSNALSEQGINSTYNITV
GGIENLDISDHTQDEIAGSNNDALIEEIITSSDDDFDYLKYANQKVALIFGDLIQFGIID
EKEVDEKYLSIIKYIDTKTFDI
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atggtggtggaggaagaaggggttacatttatcaacaacaacaattggagtaagagagca
aaaaaaaaaaaaatttcccccaacaatcttatcaagaagtttaagtctttatcttttata
tatacattgtatactagccctccccaattcatgatggagatatcaccagctaatattaaa
gaacaatcacgatccagatccagatcaagaactagaaattcaacggcaaattctcgatca
actagtgccactagaagacctagtttatcttccacccatagaagatcattatcttcatca
tcattaaacaaattaactataaccaccacacaagttgatcaagaaagatcagttccttca
gttcaagtttatttagataattcattaccattagattttttcaaacaagatattattgca
cttactaaaactttaaaaattagtaaatggcataaacgtcaattaacaattaataattta
agtattaatagaatttcgggagcattgactaatgctatttataaaattgaatatcatgat
gaatcacaaaacattcatttaccaacattattattacgagtatatggaaaaaatgttgat
gaattaattgatagagataatgaattagccatattaattaaattatctcaaaaaagaatt
ggacctagattattaggaatcttcagtaatggtagatttgaacaatttttagatggattt
attacattaaataaagaacaaattagagatgaaattctttcacaaatgttaggtagaaga
atgaaagatttacattataaaattgaattagatgctaaagattatgaaagtaaacaacca
acttgttggaatttaattgataaatggttgaaaatttttgagcaagaattattacctgga
tatttagaagttaattataaccttcaagatattttcattgttccatttgatcaatttaaa
caaattattacaaaatataaacaatggttatttaataaatatgatgataaacactttacc
aataattataaattttgtcataatgatactcaatatgggaatttattattacatgaatca
tttaatcccaaagatatagttgtatcaacatcagatactacaaatagttcgaataatatt
attgatggcgaagtcactattaaatcaacttccaacaaaaaagatactaatttagtggtt
attgattttgaatattctggagctaatttccctgcttatgatatcgttaatcatttttca
gaatggatgtctgattatcatgatccagagaaatcttatttcattcatcaagagaattat
cctaatcaattggaacaaattaatttaatcaaatcatatatcgaatatgatttccaatat
ccttcatcaaatttaaaaactggtaaaactcctgaagatttgattaataatactactaat
ccaatatcaattattcaatatgaaattgaaaaattatataatgaatgtatttattggaga
gcaacagtacaaattttttggtgtttatggggattaattcaaaatggtccattgaaaaaa
ccattaaattctaatgcattatctgaacaaggtattaattcaacttataatattactgtt
ggtgggattgaaaatttggatatttccgaccatactcaagatgaaatagcaggctcaaac
aatgacgctcttattgaagaaattatcacttcaagtgatgatgattttgattatttgaaa
tatgctaaccaaaaggtagcattaatatttggtgatcttattcaatttggtataattgat
gaaaaagaagttgatgaaaaatatttatctataattaaatatattgatactaaaactttt
gatatttaa

DBGET integrated database retrieval system