KEGG   Candida albicans: CAALFM_C305300CAHelp
Entry
CAALFM_C305300CA  CDS       T00189                                 

Gene name
CaO19.6966
Definition
(RefSeq) bifunctional choline kinase/ethanolamine kinase
  KO
K00866  choline kinase [EC:2.7.1.32]
Organism
cal  Candida albicans
Pathway
cal00564  Glycerophospholipid metabolism
cal01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cal00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    CAALFM_C305300CA (CaO19.6966)
Enzymes [BR:cal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     CAALFM_C305300CA (CaO19.6966)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Choline_kinase Choline_kin_N APH Corona_nucleoca
Motif
Other DBs
NCBI-GeneID: 3643646
NCBI-ProteinID: XP_714672
UniProt: A0A1D8PK80
Position
3
AA seq 622 aa AA seqDB search
MVVEEEGVTFINNNNWSKRAKKKKISPNNLIKKFKSLSFIYTLYTSPPQFMMEISPANIK
EQSRSRSRSRTRNSTANSRSTSATRRPSLSSTHRRSLSSSSLNKLTITTTQVDQERSVPS
VQVYLDNSLPLDFFKQDIIALTKTLKISKWHKRQLTINNLSINRISGALTNAIYKIEYHD
ESQNIHLPTLLLRVYGKNVDELIDRDNELAILIKLSQKRIGPRLLGIFSNGRFEQFLDGF
ITLNKEQIRDEILSQMLGRRMKDLHYKIELDAKDYESKQPTCWNLIDKWLKIFEQELLPG
YLEVNYNLQDIFIVPFDQFKQIITKYKQWLFNKYDDKHFTNNYKFCHNDTQYGNLLLHES
FNPKDIVVSTSDTTNSSNNIIDGEVTIKSTSNKKDTNLVVIDFEYSGANFPAYDIVNHFS
EWMSDYHDPEKSYFIHQENYPNQLEQINLIKSYIEYDFQYPSSNLKTGKTPEDLINNTTN
PISIIQYEIEKLYNECIYWRATVQIFWCLWGLIQNGPLKKPLNSNALSEQGINSTYNITV
GGIENLDISDHTQDEIAGSNNDALIEEIITSSDDDFDYLKYANQKVALIFGDLIQFGIID
EKEVDEKYLSIIKYIDTKTFDI
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atggtggtggaggaagaaggggttacatttatcaacaacaacaattggagtaagagagca
aaaaaaaaaaaaatttcccccaacaatcttatcaagaagtttaagtctttatcttttata
tatacattgtatactagccctccccaattcatgatggagatatcaccagctaatattaaa
gaacaatcacgatccagatccagatcaagaactagaaattcaacggcaaattctcgatca
actagtgccactagaagacctagtttatcttccacccatagaagatcattatcttcatca
tcattaaacaaattaactataaccaccacacaagttgatcaagaaagatcagttccttca
gttcaagtttatttagataattcattaccattagattttttcaaacaagatattattgca
cttactaaaactttaaaaattagtaaatggcataaacgtcaattaacaattaataattta
agtattaatagaatttcgggagcattgactaatgctatttataaaattgaatatcatgat
gaatcacaaaacattcatttaccaacattattattacgagtatatggaaaaaatgttgat
gaattaattgatagagataatgaattagccatattaattaaattatctcaaaaaagaatt
ggacctagattattaggaatcttcagtaatggtagatttgaacaatttttagatggattt
attacattaaataaagaacaaattagagatgaaattctttcacaaatgttaggtagaaga
atgaaagatttacattataaaattgaattagatgctaaagattatgaaagtaaacaacca
acttgttggaatttaattgataaatggttgaaaatttttgagcaagaattattacctgga
tatttagaagttaattataaccttcaagatattttcattgttccatttgatcaatttaaa
caaattattacaaaatataaacaatggttatttaataaatatgatgataaacactttacc
aataattataaattttgtcataatgatactcaatatgggaatttattattacatgaatca
tttaatcccaaagatatagttgtatcaacatcagatactacaaatagttcgaataatatt
attgatggcgaagtcactattaaatcaacttccaacaaaaaagatactaatttagtggtt
attgattttgaatattctggagctaatttccctgcttatgatatcgttaatcatttttca
gaatggatgtctgattatcatgatccagagaaatcttatttcattcatcaagagaattat
cctaatcaattggaacaaattaatttaatcaaatcatatatcgaatatgatttccaatat
ccttcatcaaatttaaaaactggtaaaactcctgaagatttgattaataatactactaat
ccaatatcaattattcaatatgaaattgaaaaattatataatgaatgtatttattggaga
gcaacagtacaaattttttggtgtttatggggattaattcaaaatggtccattgaaaaaa
ccattaaattctaatgcattatctgaacaaggtattaattcaacttataatattactgtt
ggtgggattgaaaatttggatatttccgaccatactcaagatgaaatagcaggctcaaac
aatgacgctcttattgaagaaattatcacttcaagtgatgatgattttgattatttgaaa
tatgctaaccaaaaggtagcattaatatttggtgatcttattcaatttggtataattgat
gaaaaagaagttgatgaaaaatatttatctataattaaatatattgatactaaaactttt
gatatttaa

DBGET integrated database retrieval system