KEGG   Candida albicans: CaO19.705Help
Entry
CaO19.705         CDS       T00189                                 

Gene name
GCN5
Definition
(RefSeq) bromodomain protein similar to S. cerevisiae GCN5 (YGR252W) histone acetyltransferase
  KO
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
cal  Candida albicans
Brite
Enzymes [BR:cal01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     CaO19.705 (GCN5)
Transcription machinery [BR:cal03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     CaO19.705 (GCN5)
Chromosome [BR:cal03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    CaO19.705 (GCN5)
   HAT complexes
    PCAF complex
     CaO19.705 (GCN5)
    STAGA complex
     CaO19.705 (GCN5)
    TFTC complex
     CaO19.705 (GCN5)
    SAGA complex
     CaO19.705 (GCN5)
    SLIK complex
     CaO19.705 (GCN5)
    ADA-HAT complex
     CaO19.705 (GCN5)
    HAT-A2 complex
     CaO19.705 (GCN5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
AA seq 449 aa AA seqDB search
MVDRKRTAAIRAEDDDEENDNVPLQKKVKIEAKQKEEEEDGDKSGATETKSEVKQESKEE
TTQKENNEEDEEEEEEEDDEEAEEEKKRITNFNFDGEIYTFKERPSVIEEKEGKIEFRVV
NNDNSRENLIVLTGLKNIFQKQLPKMPREYISRLVYDRSHLSMAVVRKPLTVVGGITYRP
FNNRGFAEIVFCAISSTEQVRGYGAHLMNHLKDYVRATSPIKYFLTYADNYAIGYFKKQG
FTKEISLDKSVWMGYIKDYEGGTLMQCSMLPSILRYLDSGKILLLQKAAIERKIRSRSKS
KIVRPGLQVFKTNKNVTLDPKDIPGLAEAGWSEEMDKLAQKPKRGPHYNFMVTLFSEIQN
HPSAWPFAVAVNKEEVPDYYRVIEHPIDLATIEQKLENNLYLKFTDFVDDLKLMFNNCRA
YNSETTTYYKNANKLEKFMNNKLKDCSFV
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atggttgacagaaaaagaactgcagcaatacgtgccgaggatgatgatgaagaaaatgac
aatgttcctttacagaaaaaagtgaaaatagaagcaaagcagaaagaagaagaggaagat
ggtgataagtcaggagccacggaaaccaaatctgaggtgaaacaagaatcaaaagaagaa
actactcaaaaggaaaataatgaagaggacgaggaagaggaagaagaggaagatgacgaa
gaagccgaagaagagaagaaaagaataaccaatttcaattttgatggcgaaatttacaca
ttcaaggaaagaccttcggtaattgaagaaaaagaaggcaaaatagagtttcgtgtggtg
aataatgacaatagtcgagaaaacttgattgtgctaaccgggttaaagaatattttccaa
aagcaactacccaagatgcctcgtgaatatatctcgcgtttggtgtatgatcgatcacat
ttgtcaatggcagttgtgagaaagccattaactgtggtaggtgggatcacataccgtcca
tttaacaaccgtggatttgccgaaattgtgttttgtgctatctcgtcaactgaacaagtg
cgtgggtatggtgcacatttgatgaatcatttgaaagactatgtgagggcaacatctcca
atcaaatatttcttgacgtatgcagataactatgctattgggtatttcaaaaagcagggt
ttcacgaaggaaatatcattagataaatcggtgtggatggggtacatcaaggattacgaa
ggtggtacattgatgcagtgctcgatgttaccgtcaatattaaggtaccttgatctgggt
aaaatattacttttgcaaaaagctgctattgaaagaaaaatacggtctagatctaaatca
aaaatagtgagaccgggtttgcaagtttttaaaaccaataagaatgtgacattagacccc
aaagatatccctggattagcagaggcagggtggctggaagaaatggataaattagcacaa
aaaccgaaaagaggaccacattataactttatggttacgctattcagtgaaattcagaac
cacccttctgcttggccatttgcagtggcagtcaacaaagaagaagtaccagattattat
cgagttattgaacatccaattgatttggcaacaatagaacaaaaattggaaaacaacttg
tatttaaaatttactgattttgtggatgatctaaaactaatgttcaacaattgtcgagct
tataattcggaaaccacaacatattataaaaacgcaaataaactagaaaagtttatgaat
aataaattgaaagactgtagttttgtatag

DBGET integrated database retrieval system