KEGG   Candida albicans: CAALFM_C704280CAHelp
Entry
CAALFM_C704280CA  CDS       T00189                                 

Gene name
CaO19.7140
Definition
(RefSeq) hypothetical protein
  KO
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
cal  Candida albicans
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cal00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    CAALFM_C704280CA (CaO19.7140)
Enzymes [BR:cal01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     CAALFM_C704280CA (CaO19.7140)
Exosome [BR:cal04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   CAALFM_C704280CA (CaO19.7140)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 248 aa AA seqDB search
MSKETEFYNYITTLPETTLSQVRGKPHEVLKLIDEYPQNFMNIGPHKGTQIVTRIKEKAP
KTMIELGGYLGYSAVLFANEIADDPDAKYYSFELNPEFAKIATYVIDLAGLSDKVEIIVG
RASYTLPAFRQRLFSENKHYTGLDFIFIDHWKDLYVPDLRVLESLNLIAPGTLIVADNII
TPGAPEYVVYVNFSPDEKKLYNETTKNPEGKEFIGRWNILYDTKTIEVATANHKDAIEVT
KCVDYFSG
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagaaacagagttctacaactatatcaccaccctcccagagaccaccctctct
caggtcaggggcaaaccccatgaagttttaaagttaattgatgagtacccccaaaacttc
atgaacattggcccacacaagggtacacaaattgtcaccagaatcaaagagaaagcccct
aaaaccatgattgagttgggtgggtatttagggtactcggcagtcttatttgccaacgaa
attgctgacgacccagacgcaaagtactacagtttcgagcttaacccagagtttgccaaa
attgccacctacgttatcgacttggcagggttgctggataaagttgagataatcgtgggc
agggcctcatacactttgccagctttcagacagagattgttttcggaaaataaacactac
actggattggactttatttttattgaccattggaaggatttgtatgtcccggacttaaga
gttttagagtcactcaaccttattgccccaggaacattgattgttgctgataatattatt
acgcccggcgctcccgagtacgtggtctacgtaaacttttcacccgatgagaaaaagctc
tacaatgaaaccaccaagaaccccgaaggaaaggagtttattggtaggtggaacattcta
tacgatacaaaaaccattgaagtcgcaaccgccaaccacaaagacgcaatcgaggtaact
aaatgtgttgattatttctctggataa

DBGET integrated database retrieval system