KEGG   Candida albicans: CaO19.7140Help
Entry
CaO19.7140        CDS       T00189                                 

Gene name
CMT1
Definition
potential catechol-O-methyltransferase
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
cal  Candida albicans
Pathway
Tyrosine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:cal00350]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 248 aa AA seqDB search
MSKETEFYNYITTLPETTLSQVRGKPHEVLKLIDEYPQNFMNIGPHKGTQIVTRIKEKAP
KTMIELGGYLGYSAVLFANEIADDPDAKYYSFELNPEFAKIATYVIDLAGLSDKVEIIVG
RASYTLPAFRQRLFSENKHYTGLDFIFIDHWKDLYVPDLRVLESLNLIAPGTLIVADNII
TPGAPEYVVYVNFSPDEKKLYNETTKNPEGKEFIGRWNILYDTKTIEVATANHKDAIEVT
KCVDYFSG
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagaaacagagttctacaactatatcaccaccctcccagagaccaccctctct
caggtcaggggcaaaccccatgaagttttaaagttaattgatgagtacccccaaaacttc
atgaacattggcccacacaagggtacacaaattgtcaccagaatcaaagagaaagcccct
aaaaccatgattgagttgggtgggtatttagggtactcggcagtcttatttgccaacgaa
attgctgacgacccagacgcaaagtactacagtttcgagcttaacccagagtttgccaaa
attgccacctacgttatcgacttggcagggttgctggataaagttgagataatcgtgggc
agggcctcatacactttgccagctttcagacagagattgttttcggaaaataaacactac
actggattggactttatttttattgaccattggaaggatttgtatgtcccggacttaaga
gttttagagtcactcaaccttattgccccaggaacattgattgttgctgataatattatt
acgcccggcgctcccgagtacgtggtctacgtaaacttttcacccgatgagaaaaagctc
tacaatgaaaccaccaagaaccccgaaggaaaggagtttattggtaggtggaacattcta
tacgatacaaaaaccattgaagtcgcaaccgccaaccacaaagacgcaatcgaggtaact
aaatgtgttgattatttctctggataa

DBGET integrated database retrieval system