KEGG   Candida albicans: CaO19.7207Help
Entry
CaO19.7207        CDS       T00189                                 

Gene name
DOA4
Definition
ubiquitin-specific protease; DNA replication regulation
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.4.19.12]
Organism
cal  Candida albicans
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:cal00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    CaO19.7207 (DOA4)
Enzymes [BR:cal01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     CaO19.7207 (DOA4)
Peptidases [BR:cal01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CaO19.7207 (DOA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 811 aa AA seqDB search
MKNSVKETTELDNISRALVELLKKNHDSFKSLFNVQLDLLKLFDKQVNNLEATGYCDYEV
AYALYMIIIQLIAVMKDKSNSKTADIYNGIQQSIRKKASNFKKVLGYFKNDDDEKDEDPL
INRFKSLSGEKTHPATKIKKELIYREWITPVELERTLREKHVLLIDYRPKKDYLHNHIKF
DNLINIEPRQIESLPESSTDSDLEEVLRVSLSEEEFQMFLIRNKFDLIVVYNYNYGSTSK
ERLYGILDLLEKENPFTSLIGILLNNKYISSRLKIAPSFLSGGILNWYHTLGADYLETSS
IKNGDCLKEETRYLTSFSDYLSNSKESSPSEVTLANENNSAYIRPVQKKVEQFDSIPPKS
TATVYSSPKVELPLTPTSSTPNSPAPPLQPLSSNGKSPNNVTAKDVTVSSKKSQFLESYA
TGLVNLGNSCYMNCVIQCLAATPQLTSFFFPTITESFSDHSYKRHINVNNKLGTKGMLTT
SFVELILSMLNNNGRSFSPSKFKKIMGSLSPARQFASFDQQDCIEFLNFLLDALHEDLNQ
VTIADPQERKMITELTPEQEKNREILPVRLASTIEWERYLKLNFSIIVDYFQGQYLSQLK
CLECGFTSTTYNAFSILSLPIPEKLNKSMKVSLDECLQEFVTTELLDDNNKWYCPNCKKF
TKSTKKIAITRLPQVLIINFKRFKMTASGGFHKLETFVTYPVNEELDMTPYWPDVGSTIS
ANNSMSIEREKEILSTFPVRSQVPPFKYKLFGVANHYGNLTTGHYTAYVHKSSDSKKARN
WCYFDDSRVTFNKSPNDVLNKNAYCLFFQRI
NT seq 2436 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatctggtaaaagagactacggaactagataacatttcaagagcattggttgaa
ttactcaaaaagaatcatgacagtttcaagtctttgtttaatgttcaacttgatctacta
aaactatttgataaacaagtaaacaatttggaggctacagggtattgtgattatgaggta
gcatatgcactatacatgatcatcattcaattgatagccgttatgaaggataaatcgaat
tccaaaactgccgacatatacaacggaatacaacaatctattcgaaagaaagcaagcaac
tttaaaaaggtgttagggtatttcaaaaatgacgacgatgaaaaggatgaagatcccctt
attaatagattcaagtctttgagcggagagaaaacacatccagcaaccaagatcaagaaa
gaattaatataccgcgaatggataacacctgttgaactcgagaggacgcttcgcgagaaa
catgtgttgttaatagactatagaccaaagaaggattatttacacaaccatatcaagttt
gataatttgataaatatagaaccacgacaaattgaatcattaccagaatcttcaacagat
tccgatttggaagaagtattgagagtatcattgtcggaagaagaatttcagatgttttta
attcggaacaagtttgatttgattgttgtctataattataactatggctcgacgtcaaaa
gagagactttacggaatactagatctactagaaaaggaaaacccattcacttctttgata
gggatattattgaataataaatacatcagttcgagattaaagatagctccgctgtttctc
tcgggtggaattttgaattggtaccatactctcggtgcagattatttagagactagctcg
atcaaaaatggagactgtttaaaggaagaaactaggtacttaacttcatttagtgattat
ctttcgaattcaaaagagagtctgccttcagaagtcacacttgcaaatgagaacaacagt
gcttatattagaccagttcaaaagaaagtcgagcaatttgattctataccaccaaaaagt
actgctacagtgtactcgtcacccaaagttgagttacccttaactccgacttcatccacc
cccaattcgccggcgcctcctttgcaacctttgctgtcaaatgggaagctgccaaacaat
gttacagctaaagatgttactgtttcgtcgaaaaagtcacaatttctcgaactgtatgcc
actggtttggtcaatttgggaaattcatgttatatgaactgtgttattcaatgtttggct
gcgactccacagcttacttcattttttttccccacgataactgaatcgttttcggaccat
tcatacaaacgacatataaacgtgaacaataaattagggacaaagggaatgttgacaacc
agttttgttgaattgatattgagtatgcttaacaacaatggacgctcattcagtccttct
aagtttaagaaaataatgggttcgttgtcaccggctcgacagtttgcttcctttgatcaa
caagactgtattgagtttttgaattttcttttggatgcgctccatgaggatctcaatcaa
gtgaccatagccgacccacaggaaagaaagatgatcactgaattaacccctgagcaggaa
aaaaatagagaaatattgcctgtcagattagcttccactatagaatgggagaggtacctc
aaactaaatttttctataattgttgactattttcaagggcaatatttatcccaattgaaa
tgtttagaatgtggatttacttcaacaacttataatgcgttttcgatactttcactaccc
atcccggagaaactaaacaaactgatgaaagtttctttggatgaatgccttcaagaattt
gtgacaacagagttgcttgatgataataacaagtggtattgtcccaattgtaaaaaattt
accaaactgacaaagaaaattgcaattactagattaccccaagtattgataataaatttt
aagcggttcaaaatgaccgccagtggtggatttcacaaattggaaacttttgtgacttac
cctgtgaatgaagaattggacatgactccgtattggccggatgttggctctaccatcagt
gccaacaattcaatgtctatagaaagggaaaaagagattttgagtactttcccagttaga
agccaagtaccgcctttcaaatacaaattgtttggcgtggctaatcattatggtaattta
actactggacactatactgcttatgtacataagagtagtgattcaaagaaagcaagaaac
tggtgttactttgatgattctagagtaactttcaacaaatcaccaaatgatgtattgaat
aagaatgcctattgtttattctttcagagaatatag

DBGET integrated database retrieval system