KEGG   Candida albicans: CaO19.7208Help
Entry
CaO19.7208        CDS       T00189                                 

Gene name
CSK1
Definition
mitogen-activated protein kinase similar to S. cerevisiae SMK1 (YPR054W) which is required for spore morphogenesis; likely intron and 5' exon upstream
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
cal  Candida albicans
Brite
Enzymes [BR:cal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     CaO19.7208 (CSK1)
Protein kinases [BR:cal01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [Table]
   CaO19.7208 (CSK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 284 aa AA seqDB search
MCCQIATLLDLDVVYVKPYEGLYCFQELADLDLARVLYSNVQFSEFHIQSFMYQILCGLK
YIHSADVIHRDLKPGNILVTTQGTLKICDFGLARGINPVYFRNRSAVITNYVATRWYRAP
ELIMSTKNYTKAVDIWAVGCILGELFGRRPLFPGKNSHEQIHELFKIIGNPPIETIKKYN
WKVEGLLWVKYRPVKWKSLYPFAPLNALELLDSLLQWDYKARLEVEQILEQEFFKNLRNV
HEEPSSKAIFDFSFEEKGKSIPQLKEILETEVRVFKEISKTGIE
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgtgttgtcagattgcaactttgcttgacttagatgttgtatatgtgaaaccttatgaa
ggcttgtattgttttcaagagctagccgatttagatttagctcgtgttttgtactcaaac
gtccaattttcagaatttcacattcaaagctttatgtaccaaattctttgcggactcaag
tacatccattctgctgatgtaatacatcgcgacctaaagccaggaaacatattggtcacc
actcaagggactttaaaaatatgtgatttcggcttagcacgaggaataaatcctgtatat
ttcagaaaccgctcagctgtcatcacaaactacgtagcaacacgctggtatagggcaccc
gaattaataatgtccactaaaaactacacaaaagcagttgacatctgggctgtgggttgt
attcttggtgaattgttcggtagaagaccattatttcctggtaaaaatctgcacgagcaa
attcatgaactattcaagataataggcaatcccccaattgaaaccatcaaaaagtataac
tggaaagtggaaggactactttgggtaaagtatcgaccggttaaatggaaaagcttgtat
ccatttgctcccttgaatgcattagagttgttagacagccttctacaatgggattacaaa
gcaagattagaagttgaacaaatactagaacaagaatttttcaagaacttgcgaaacgtt
cacgaagaaccatcaagcaaggcaatttttgactttagttttgaggagaaagggaaaagt
attccacaattgaaagagatacttgaaacggaagtaagagtattcaaagagatttctaaa
acgggaatagagtga

DBGET integrated database retrieval system