KEGG   Candida albicans: CaO19.7281Help
Entry
CaO19.7281        CDS       T00189                                 

Definition
potential histidine kinase-like ATPase; similar to S. pombe SPAC644.11c predicted pyruvate dehydrogenase kinase; similar to S. cerevisiae YIL042C predicted mitochondrial protein kinase
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
cal  Candida albicans
Brite
Enzymes [BR:cal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     CaO19.7281
Protein kinases [BR:cal01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   CaO19.7281
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
R
AA seq 511 aa AA seqDB search
MGTAWELTQALKDQIFKYASFNQTPVSLRQMVQFGPVPSPGSIFLASRFIVEELPIRLAK
KVKDLENAPLGLNEMPSTIQVKNWYAQSFQELTELHKPKISDELAKLLSKGASKHSLPED
SINEKPHTKQEIHRIPDSLEDNPAINNIFSDDGIVVRHHHHHHSISRARPRLNDNTQTRV
ESPTYGMSYFNPCPGNIVWPKEVYDYNKLVRETLEIIKKRHDATVATMAQGVQEWKNKNQ
TVMVNSQIQTFLDRFYMSRIGIRMLIGQHIALNMAQNSPTKQRLSSLINGSQGTTKKPRS
NYVGVICTDCNVGEIAEDAIETAKYICEEYYGLFEAPEIQLIAPQQDINFMYVPGHLIHM
LFETLKNSLRATIEFHTPKLKQKLIDEDPNLKFDEIDINDLKFPPIKVIISEGTEDIAIK
ISDEGGGIPRSSLPLIWTYLYTTVNETPKLEPEYDQTSFKAPMAGFGYGLPISRLYAQYF
GGDLKLISMEGYGTDVYLHLNRLSSSNEPLP
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgggtacagcttgggaattaacacaggctctcaaagatcaaatattcaaatatgcttcc
ttcaatcaaaccccggtgtcgttgagacagatggtccaatttggtcctgttccttcccca
ggttcaattttcttagcatcaagatttattgttgaagaattaccaatccgattagctaaa
aaagtgaaagatttggagaatgcaccattaggattgaatgaaatgccatccacaattcag
gtgaaaaattggtacgcccaatcctttcaagaattaacagaattacataaaccgaaaatt
agcgacgagttggcaaagctcttgtctaaaggtgccagcaaacattctctaccagaggat
tcgataaatgaaaaacctcataccaagcaagagattcatcgtatacccgacctgctagaa
gataacccagccatcaataatatttttagcgacgatgggatcgttgttcgacatcaccac
catcaccattccatttccagagcaagaccccgtttaaatgacaatacccaaacaagagtt
gaatcacctacatatggtatgtcgtactttaacccatgtccggggaacattgtgtggcca
aaagaagtctatgactacaacaaattggttcgtgaaacattggaaataatcaagaaaaga
cacgatgctacagtggcaactatggcacaaggggttcaagaatggaaaaataaaaatcaa
actgtgatggtcaattcccaaattcagacatttttagatcgtttctatatgtcgagaatt
ggtataagaatgttgattggtcaacatattgctttgaatatggctcagaattcaccaaca
aaacagagattaagctcattgattaatggttctcaaggaaccaccaaaaagccacgttca
aattatgttggtgtcatttgtactgattgtaatgtcggggagattgctgaagatgctatt
gaaactgccaaatacatttgcgaagaatattatgggttattcgaagccccagaaatacag
ttgattgcacctcaacaagatataaatttcatgtatgttcctggacacttgattcatatg
ctttttgaaactttgaaaaactcattgagagcaactatcgagttccatacaccaaagttg
aaacaaaagttgatagatgaagatccaaatttgaaattcgacgagattgatataaatgat
ttgaaatttcctcctataaaagtaattattctggaaggtacagaagacattgccataaaa
atttccgacgagggaggcggtatacctaggtcatcattaccattgatttggacgtacttg
tacacaaccgtgaatgaaactccaaaattagagcctgaatatgatcaaacttcatttaaa
gcaccaatggctggttttggttacggtttaccaatcagtagattatatgcacaatacttt
ggtggtgatttgaagttgatttccatggaaggctacggaactgatgtttacttgcatttg
aacagattaagcagttctaatgaaccgcttccatga

DBGET integrated database retrieval system