KEGG   Candida albicans: CaO19.7293Help
Entry
CaO19.7293        CDS       T00189                                 

Gene name
MPS1
Definition
protein threonine/tyrosine kinase
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
cal  Candida albicans
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:cal00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    CaO19.7293 (MPS1)
Enzymes [BR:cal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     CaO19.7293 (MPS1)
Protein kinases [BR:cal01001]
 Serine/threonine protein kinases: Other group
  TTK family
   CaO19.7293 (MPS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
R
AA seq 690 aa AA seqDB search
MPHDLLSHVATSFSSHRSSPSSNNSTKRRLALEDDPTVLPPALSSYSIQCLNERTKTSTL
PSQITGKYELDFPDSSSKRDNTLRNKLAAHFTNESTRSREISNSFTNLSEDRSSINTAAT
TTPGSKTFEDLRSKRKRRFGKSLGPPKRGTDFVQESTPIGDELSPKIESKFNITPQHKSL
SEIIPKAPSLERFSPLLKKNHSSIDAEDTITKRIEARRREQMEQEFVKKEKENELAELKI
KKLEQIAALQSPYEEHKSKEFQEPKQSRMPLREIPVNSAVDVFRKPKAPKSAISPSPNVQ
SNSMIPPAQPVFRNTLQDFPKPPQQPQASSQNQQQVLPSAPIPPKAHYDRPQHSGNKRAL
IINDKSYEKLELIGKGGSSKVYRVRSLNNNCVYALKKVELGQFEDVSGFKGEIDLLTKLK
SCERVVTLVDYATTESSLYLIMEKGDLDLAEVLQYRLKLDAPLDLNFVKYHTIEMFKCIK
DVHDAGIVHSDLKPANFLFVRGMLKIIDFGIANAVPDHTINVYRENQIGTPNYMAPEAIC
ESNYTSARIWKVGKPSDIWSIGCILYQFIYGKAPFAGYSGNQKLMAITNPHIKISFPSSG
IGNTPVPVSAIELMKNCLHRDPNDRWTIEQCLTCDFLSPKIVSENFIREVVHQSINYGYN
SRISGDGMTSDRYDALVDSVMKQIQNLNYS
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atgccacatgatttattatcacatgtggcgacgagtttttccctgcatcggtcgtcacca
tcaagcaacaattcaaccaaacgacgtttagcattagaggacgacccaacagttctaccc
ccggcattaagctcatatagcatacagtgtttgaatgaaagaaccaaaacttctacacta
ccatctcaaataacaggaaagtatgagttagatttcccagattcctccagtaaaagagac
aatacattacgaaacaaactagctgcacattttacaaacgaatcaacccgatctcgtgaa
atatctaattcatttacaaatttgtctgaagatagatcaagtataaatactgcagcgaca
acaacaccaggcagcaaaacatttgaagacttgcgtagtaaacggaaaagaaggttcggc
aaactgttgggaccccccaaaagaggtactgactttgttcaagaaagcacaccaattgga
gacgaactatcacctaaaattgaaagcaagtttaacattacaccgcaacacaaactgttg
agtgaaataataccaaaggccccgtcgttagaaagattctcccctcttttgaagaaaaac
cattcatccatagatgctgaggataccattacaaaacgaatcgaagcaagacgacgagag
caaatggaacaagagtttgtgaaaaaagaaaaggaaaacgaattggccgaattgaaaata
aaaaaacttgaacaaatagcagcactacagtctccttacgaagaacataaatctaaagag
ttccaagaacccaaacaaagtcgtatgccactccgtgaaatacctgtcaacagtgctgtt
gatgttttccgcaaaccaaaagcccctaaatctgctatatccccctcacctaatgtgcaa
agcaattccatgatacccccggcacaaccagtatttagaaatacgttacaagactttcca
aaacctccccaacaacctcaagccagtagccaaaatcagcaacaagtattgccctctgca
cctataccacccaaagctcattacgatagaccccagcattctggaaataaacgagcatta
ataataaatgataaactgtacgagaagttggaacttataggaaaaggaggatcatctaaa
gtataccgagtgagatccctcaataacaattgtgtctatgctctcaaaaaagttgaactt
ggtcaattcgaagatgtgagtggattcaaaggggaaattgatttacttacaaagctaaag
tcatgtgaaagagtagtgactttggttgattatgccaccactgaaagttcgctttatctt
ataatggaaaaaggtgatcttgatttagccgaggttcttcaatatagattgaaattggat
gctccgttggatttgaactttgttaaatatcacacaattgaaatgtttaaatgcataaaa
gatgttcacgatgctggcattgtacatagtgatttgaaaccagcgaattttttgtttgtt
aggggcatgttgaaaatcatagactttggtattgctaatgctgtacctgaccacaccata
aatgtttacagagagaaccagattggtacacccaattacatggcacccgaagccatttgc
gaatcaaattatacctcagcaagaatttggaaggtaggcaagccttcggatatatggtca
atcgggtgtattttgtatcaattcatatacgggaaggcaccttttgctggatattctggc
aatcaaaaattgatggctataactaatccgcatataaagatttccttccccagtagtggc
attggaaataccccggtgcctgttagtgctatcgaattgatgaaaaactgtttacaccgt
gacccaaacgatagatggacaattgaacaatgtctaacttgtgactttctactgccaaaa
atagttagcgagaattttattcgggaagttgttcaccaatctataaactacggttataat
agtaggatttcgggtgacggtatgacaagtgatagatatgatgctttggttgactctgta
atgaaacaaatacaaaacttaaactacagctag

DBGET integrated database retrieval system