KEGG   Candida albicans: CaO19.7307Help
Entry
CaO19.7307        CDS       T00189                                 

Definition
oxidoreductase FAD binding and NAD binding domains; similar to S. cerevisiae YML125C
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
cal  Candida albicans
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:cal00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
R
AA seq 285 aa AA seqDB search
MEDKRELLKQPIHGIYIPIGLILFGTWIFGWEYMPYSIGFIVVIVSIQYYGALKRASSMH
QVKWQEFELLDKTLIAPMTSIYRFKLRREDEVLDIPTGHSLACCFNVDGKDEVRFYTPIS
NQFDKGFFDILVKHYEHGVVTKKLANLQVGQTVQFRGPFGKLQYVPNSAKELALVAGGTG
ITPMLQVITAIITNLEDDTKIKLLFANNTERDILLKDELDNMAQKYPGLEIKYVTGKFVD
KKSFEFLPSPTSDSKIFICGPPAFVEYINEMTKDAGFEKDQVFCF
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggaggataaaagagaattactcaaacaaccaattcatggtatatatattccaataggg
ttaattttatttggtacctggatttttggttgggaatatatgccatattcaatcggattc
attgttgtcatagtgtctatacaatattatggtgctttgaaacgtgcttcttctatgcat
caagttaaatggcaagaatttgagttgttggataagacattaattgcccccatgacatcg
atttatcgtttcaaattaagaagagaagatgaagtgttagacattcctactggacattct
ttagcttgttgttttaatgttgatggtaaagatgaagtcagattttacactccgatttct
aatcaatttgataaagggtttttcgatattttggttaagcattatgaacatggtgtcgtt
acaaaaaaattggctaatcttcaagttggacaaacagttcaatttagaggaccatttgga
aaattacaatatgtaccaaatctggctaaagaattggctttagttgcaggaggcactggt
attaccccaatgttacaagtcattactgctattatcactaatcttgaagatgatactaag
atcaaattattatttgctaataacaccgaaagggatatattattgaaagatgaattggat
aatatggcacaaaaatatccaggattggaaattaaatatgttacaggtaaatttgttgat
aaaaaactgtttgaatttttgccttcaccaacttctgattcaaaaatatttatttgtggt
ccaccagcatttgttgaatatatcaatgaaatgactaaagacgctgggtttgaaaaagac
caagtgttttgtttttaa

DBGET integrated database retrieval system