KEGG   Candida albicans: CaO19.7354Help
Entry
CaO19.7354        CDS       T00189                                 

Gene name
LAC1
Definition
Longevity-assurance gene 1 cognate (LAG1 cognate)
Orthology
K04709  
Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
cal  Candida albicans
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Ceramide biosynthesis
Brite
KEGG Orthology (KO) [BR:cal00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    CaO19.7354 (LAC1)
Enzymes [BR:cal01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.24  sphingosine N-acyltransferase
     CaO19.7354 (LAC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 427 aa AA seqDB search
MSSGSIATTTIPSTPMSIESIEDHQYHNSFLAMVERNQIPLSRNLLIILYLSHLLLQNNN
TTITPYTSKFIHIQNCVGIDEFTGKSIYDIDINDTYFVIHSLVIVTFLRSFLMKWCFEPF
ASKFCHIHSKKAKTRFAEQSWSFVYYSISFIFGVVLYWDSPYYNNLDQVYINWPNHYMSW
EFKTYYLVSMGFWLQQIFVLNVEKPRKDHYQMFSHHIITCLLIIGSYYYYYFRIGHLILM
IMDSVDIFLAAAKMLKYAGFSNACDAMFLLFLVSWIVLRHGVYNYIFYHAWYKSVDLMKN
GQCVEGLMQKRCWTPVVIDTFLGLLGGLQIITCIWMYLILKVAYKVVTGSGAEDVRSDED
DTDIELEEEEKEEEEEEEVGQPIFVEKKEEEVVLEIEEDKYSFERDSFSSSSESTLDEKK
DIRKRKV
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgagttcaggatcaattgcaactacaacaatacccagtacaccaatgtctattgaatca
atagaagatcatcaatatcataattcttttttagccatggttgaaagaaatcaaataccg
ttatctagaaatctattaataattttatatttatcacatttattattacaaaataacaat
accactattactccttatacatccaaatttatacacattcaaaattgtgttggtattgat
gaattcactgggaaatcaatatatgatattgatattaatgatacatattttgtgattcat
tcattagtcattgttacatttcttcgttcattcttgatgaaatggtgttttgaaccattt
gcatcgaaattttgtcatattcattcgaaaaaagccaaaactagatttgctgaacaaagt
tggtcatttgtttattattcaatttcatttatatttggcgtggtattatattgggatagt
ccttattataataatttagatcaagtttatatcaattggccaaatcattacatgtcatgg
gaatttaaaacttattatttagtaagtatgggattttggctacaacaaatttttgtttta
aatgttgaaaaaccaagaaaagatcattatcaaatgtttagtcatcatatcattacttgt
ttattgattattggttcatattattattattatttccgtattggtcatttaatattgatg
attatggattcagtagacatttttttggcagcagcaaaaatgttaaaatacgctgggttt
agtaatgcatgtgatgccatgtttcttttatttttagtcagttggattgtattaagacat
ggagtatataattatatcttttatcatgcttggtataaatcagttgatttaatgaaaaat
ggacaatgtgttgaaggattgatgcaaaaaagatgttggactccagttgttattgataca
tttttgggtttactcggaggattacaaattataacttgtatttggatgtatttgatatta
aaagttgcttataaagttgttactggatcaggtgctgaagatgttcgaagtgatgaagat
gacactgatattgagttggaagaagaagaaaaagaagaagaagaggaggaggaagtagga
caaccaatatttgtggaaaaaaaggaagaagaagttgtattagaaattgaagaagataaa
tactcttttgaaagagattcatttagttcatcatcagaatcaactttggacgagaaaaag
gatattaggaaaagaaaagtataa

DBGET integrated database retrieval system