KEGG   Candida albicans: CaO19.7387Help
Entry
CaO19.7387        CDS       T00189                                 

Gene name
ELP3
Definition
Elongator Protein; Histone Acetyltransferase
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
cal  Candida albicans
Brite
Enzymes [BR:cal01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     CaO19.7387 (ELP3)
Transfer RNA biogenesis [BR:cal03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    CaO19.7387 (ELP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 547 aa AA seqDB search
MPVQKNKVPEKERFIQCCGDISLELVASLKSSKDINLNGLITRYAKKYKLKQQPRLTDII
SSIPDQHKKYLIPKLKAKPVRTASGIAVVAVMCKPHRCPHIAYTGNICVYCPGGPDSDFE
YSTQSYTGYEPTSMRAIRARYDPYEQARGRVDQLRQLGHSIDKVEYIIMGGTFMSLPIDY
RENFITQLHNALTGFNGNNIDEAIEFSQQSQTKCVGITIETRPDYCTETHLSDMLKYGCT
RLEIGVQSVYEDVARDTNRGHTVKAVCETFAVAKDAGYKVVSHMMPDLPNVGMERDLEQF
KEYFENPEFRTDGLKLYPTLVIRGTGLYELWKQGLYKSYNANALIDLVARIMALVPPWTR
IYRVQRDIPMPLVTSGVENGNLRELALARMKDFGTSCRDVRTREVGIQEVHHKVVPDQVE
LIRRDYYANGGWETFLSYEDPKQDILIGLLRLRKASKKYTYRKEFASQPTSIVRELHVYG
SVVPLHSRDPRKFQHQGFGTLLMEEAARIAKEEHGSEKISVISGVGVRNYYAKLGYELDG
PYMSKML
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgccagttcaaaagaataaagttccggaaaaggaaagatttatacaatgttgtggtgat
atctccttagaattagttgcatcactcaagagctccaaagatatcaatttgaatggatta
ataacacgatatgccaaaaaatataaattaaaacaacaacccagattaaccgatatcata
tcttctatacctgaccaacataagaaatatttgattccaaaattaaaggcaaaaccagtt
agaacagcgtcaggtattgctgttgttgctgttatgtgtaaaccacacagatgtcctcac
attgcatatacaggaaatatctgtgtttattgtcctggtgggccagactcggatttcgaa
tatagtacacaatcttataccggttacgagccaacttcaatgcgtgccatcagagcaaga
tacgatccttatgagcaggcaagaggtagagttgatcaattgagacaattgggacattct
atagataaagttgagtatattattatgggtggtacattcatgtctttgcctattgattat
agagaaaattttataacccaattacataatgctttaactgggttcaatgggaataatatt
gatgaagctattgagtttagtcagcagctgcaaactaaatgtgttggtattactattgaa
actagaccagattattgtacggaaacccatttaagtgacatgttgaaatatggttgtacc
agattagaaatcggggttcaatcggtttacgaagatgttgctagagatactaatcgtgga
cacactgttaaagcagtttgtgaaacatttgctgttgccaaagatgccggttataaagtt
gtatcgcatatgatgccggatttacctaatgtcggtatggaaagagatttagagcagttc
aaagaatactttgaaaatcctgaatttagaactgatggtttaaaactatatccaactttg
gttattcgaggtactggtttatatgaattatggaagcaaggattatacaaatcttataat
gctaatgccttgattgatttagtggctcgtataatggcactcgtcccaccatggacccgt
atttatcgtgtgcaaagagatattcctatgccattggtgacctctggggttgaaaacggt
aacttgcgtgaattggcccttgctagaatgaaagactttggtacttcatgtagagatgtg
cgtacaagagaagttggtatacaagaagttcatcataaagttgttcctgaccaagtcgaa
ttaattagacgtgattactatgcaaatggaggttgggaaacatttttaagttatgaagat
ccaaagcaagatattttaattggattattaagattgagaaaagcaagcaaaaagtatact
tatcgtaaagagtttgcttctcaaccaacatcgattgttagagaattacatgtgtatgga
tcggtggtacccttacattccagagatccaagaaagttccagcatcaaggctttggtaca
ttattaatggaggaagctgctagaattgctaaggaagaacacggctcagaaaaaattagt
gtgatttctggtgttggggtgagaaactattacgccaaattaggttacgaattagatggt
ccttacatgtcaaaaatgttgtaa

DBGET integrated database retrieval system