KEGG   Candida albicans: CaO19.7388Help
Entry
CaO19.7388        CDS       T00189                                 

Gene name
PBS2
Definition
member of the HOG1 MAPK cascade
Orthology
K11227  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
cal  Candida albicans
Pathway
MAPK signaling pathway - yeast
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - yeast [PATH:cal04011]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 545 aa AA seqDB search
MVEDKDIDLNINNLKIHDAPTRTPPVSSPPALPTPPTPSGISLNTTMQAKLMAFQQQRSK
AAAAAAAAASVSSSSSGTQASSSSISASTSESSVSTIPANINRTVSGKKKPKPNLKLSDL
PLSRNNSLHRSNTSASDSSVTTPEADTPTGKISNEPQPQGLFANYSDYVDIKSGQLNFAG
KASLHSKGIDFSSGSSFRVSLDEFEYLEELGRGNYGSVSKVLHKPTGVLMAMKEVRLELD
ENKFTQILMELDILHKCDSPYIVDFYGAFFVEGAVYMCIEYMDGGSLDRIFGNDVGVKDE
YELAYITESVILGLKELKDKHNIIHRDVKPTNILVNTQGKVKLCDFGVSGNLVASLAKTN
IGCQSYMAPERINTMRPDDATYSVQSDVWSLGLTILELAVGHYPYPAETYDNIFSQLSAI
VDGEPPKLYPKVYSKEAQIFVKSCLAKNPDLRPSYAALLNNPWLIKNRGKETNLAQTVKD
RVEEIAKLEKNKSVSRSNSMNKSAAAVPPPRNVESVQSLLRNKVKAPALHRGGLQKVNRS
FLNNH
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atggttgaagataaagatatagacttgaatattaataatttgaaaattcacgatgcgcca
acacgaacaccaccggtaagcctgccaccagctttaccaacaccaccaactccctcaggg
attctgctcaacactacaatgcaagctaaattgatggcctttcaacaacaaagatcgaaa
gcagcagcagcagcagcagcagcagcttcagtttcatcatcatcatcaggtacgcaggcg
tcatcgtcatctatatcagcttcaacatcggaatcgagtgtatcaacaataccagcaaat
attaaccgaactgtatcgggtaaaaagaaacccaaaccaaacttgaaattaagtgattta
ccattgtcacgtaataatagtttacaccgttctaacactagtgctagtgattcaagtgtg
actacgccagaagcagatacccctaccggtaagatttcaaatgaaccacaacctcaaggt
ttgtttgctaattattctgattatgttgatataaaatcaggtcaattaaattttgctggc
aaagcatcattacattctaaagggattgattttctgtctgggtcttcatttagagtttca
ttagatgaatttgagtatttagaagaattgggccgtggaaattatgggtctgtactgaaa
gtcttacataaacccaccggtgtattgatggcaatgaaggaagttcgattggagttagat
gagaataagttcacgcaaatactaatggagttagatattttacataaatgtgactcgcca
tatattgttgatttttatggggctttttttgttgaaggtgcagtttacatgtgtattgag
tacatggatggaggttcgttggatagaatatttggtaacgatgttggtgttaaagatgaa
tatgaattagcctatatcactgagtcggttatacttggacttaaagaattgaaagataaa
cataacattattcatcgtgatgtcaaacccactaatattttagtgaacacccagggaaaa
gtaaagttgtgtgattttggtgtgtctggtaatttagttgcctcattagccaaaacaaat
attggttgtcaatcatatatggcaccggaaaggatcaacactatgagacctgatgatgcc
acttattcagttcaatcagatgtttggtcattggggttgacgatattagaattagctgtt
ggccattatccttaccctgctgaaacatatgataatattttctcgcaattaagtgctatt
gttgatggtgaaccaccaaaactttacccaaaggtatactccaaggaggcacaaatattt
gtcaaatcttgtcttgccaaaaacccagatttaagaccatcttacgcggcattattgaat
aatccatggttgatcaaaaacagaggtaaagagaccaatcttgctcagacagtaaaagat
agagtagaagaaattgcgaaattggagaagaacaagagtgtcagtcgaagcaacagcatg
aacaaatcagcagccgcagtgcctcctccgagaaatgttgaaagtgttcaatcattattg
agaaacaaagtgaaggctccggcattacatagaggtggtttacaaaaagtgaatagaagc
tttcttaataatcattga

DBGET integrated database retrieval system