KEGG   Candida albicans: CaO19.744Help
Entry
CaO19.744         CDS       T00189                                 

Gene name
GDB1
Definition
similar to S. cerevisiae GDB1 (YPR184W) glycogen debranching enzyme
Orthology
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
cal  Candida albicans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cal00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CaO19.744 (GDB1)
Enzymes [BR:cal01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     CaO19.744 (GDB1)
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.33  amylo-alpha-1,6-glucosidase
     CaO19.744 (GDB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 1527 aa AA seqDB search
MSEARTVLFRLSNLGEPVNNENIANGVLILPVVELPSNYKPGDALFQLRFQLNAASKVSR
NGTLYTNVPSKYEQDFDRNTHYQYPIKSSFHEDITITVPIYKPGSYNYYIEYDDEEDNKK
TTEKYYFNVPPNLTINGKFVPFNNINVETVVSKWIGPYENWDKFFKIVAQKGYNMIHFTP
LQERGESDSPYSIYDQLKFDPKIFPGSDKDAIQKIHKVLNDNQLLSLTDVVWNHTANNSE
WLREHPDSGYNATTAPHLIPAIELDEALLEFSHSLQELGLPTVLESEADLQKVMDGIQTH
VLDKLKLWEYYVFNKRQTIVDLEKSFNDNKNNINKIQIPNDVDSQDLKQLSDYVLKVANI
NPTPIIGDRFANKLNVDKFLGVLFTVFDNNVEFETIANRAEEIIDEINSDLYAAFDDDTN
SIKQQVADRIKYLRLADNGPKLGEITDKSPLTEPYFTRFTDVNGKKQALANNGWIWGGNP
LVDFASNKSKAYIRREVIVWGDCVKLRYGEKFEDSPETWKRMIEYTQLSAKTFNGFRIDN
CHSTPLHVGERLLDEARKVNPNLYVIAELFSGSEEMDKIFVERLGINSLIREAMQAWSVG
ELSRLVHKHGGRPIGSLTWLPLDDFTYPAANEPVKDKFIDGYTELEIPKVLTCQAPHAIF
MDCTHDNEMPAQKRTVEDTLPNAALVAFCSSAIGSVFGYDECYPKLLNVVSETRHYDLDS
DNGIGKVKAKLNKIRDDLVQESEDVTRDHEMYIHHEGQYITIQRYNARTGNGWFLIARSK
FSDHESAQGLSPSILGGTKVKHQFSYSLIRQPGDYESQQDKLTGIPVQVEAIQSPSIEYT
DDGDSIITIDEASFIPGSIAVFSTEIPGVDVKLDNFVKQGAIEASIGLDLYDLNALLYRA
STEELDASNGKDDVYDIPGYGRLTYAGLEGWNTALKHVIWQNNLGHAICDHLRNGDWAFD
YVVNRLDKYAAKSENLSKFQDWLRSRFDAVKKSKAPYFLRPHYFALIMGIAYEAARFRVI
RQMSDGIKVATNFVQSLALTSVQMVGYMQNTSLVPDKQVPCMAAGLPHFSNDYMRCWGRD
VFIAFRGLLIVTGRYDDAKQHILGFAKTLKHGLIPNLLDAGRNPRYNARDAAWFFLQAIQ
EYVTYAPNGIDILDEKVTRRFPLDDTYIPVDDPQAFSYESSIREIIYEILSRHAKGIKYR
EANAGPNLDSQMRDEGFNVEVGVDWTNGLIYGGNQFNCGTWMDKMGESEKAHNKGIPGTP
RDGSAIEIQGLLKSALRFVNKLHKQGKFEYTKVTKPDGSTISLEDWESLLAENFEKHYYV
PKDPQQDDQYVIDPSIVNRRGIYKDLYNSGKPFEDYQLRPNFAIAMCVAPELFTPEKALG
AIIIADKAIRGPIGMRTLDPSDWNYRPYYENSIDNDDFATSKGRNYHQGPEWVWNTGYFL
RAFLLFHHLEEESSKASSSSPSIKILTLLNDRLQGHIKWIKESPWNGLTELTNKDGSYCQ
DSSPTQAWSGSCLLDLYYDLWNDKHFQ
NT seq 4584 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaagcacgtactgttttatttcgattatccaatctaggtgagccggtcaataat
gagaatattgctaatggagtgttgattttaccagtagtagaattaccatcaaattataaa
ccgggtgatgctttattccagcttagatttcaattaaatgctgctagtaaagtatcaaga
aatgggactttatacactaatgtgccctcaaagtatgaacaagattttgatagaaacact
cattaccaatatccaattaaatcgtcgtttcatgaagatattacaattactgttccaatt
tataaaccaggtagttataactattatattgaatatgatgatgaagaagataataaaaaa
accactgaaaaatattactttaatgtcccgccaaatttgactatcaatggtaaatttgtt
ccattcaataatatcaatgttgagaccgtggtttccaagtggattggtccttatgaaaac
tgggacaagtttttcaagattgtggcacaaaaggggtataatatgatccatttcactcca
ttacaagaacgtggtgaatccgattccccttattcgatttatgatcaattgaagtttgac
ccgaagattttccctggcagtgataaagatgctatacaaaaaatccataaagtgttaaac
gataaccaattgttgtcattaaccgatgtcgtttggaatcatactgccaataattctgaa
tggttgagagaacacccagattcaggttacaatgctactactgcccctcatttgattcca
gcaattgaattagatgaggcattgttggagttttcccacagtttgcaagaattaggttta
ccaacagtccttgaatcagaagcagatttacaaaaagtcatggacggtattcaaactcac
gtgttggataaattaaaattatgggaatattatgttttcaataaaagacaaacaatcgtt
gacttggaaaaatcttttaatgacaataagaacaatatcaataaaatccaaattcctaat
gatgtcgactctcaagatttgaaacaattgagtgattatgttttaaaagtggccaatatc
aatccaacacctattataggcgacagatttgccaacaagttgaatgttgataaattttta
ggggttttatttacagtatttgataacaatgttgaatttgaaaccattgccaacagggct
gaagagattattgatgagataaatagtgatttgtatgctgcatttgatgatgataccaat
agtatcaaacaacaagttgccgatcgtatcaaatatttgagattggctgataatgggccc
aaattaggtgaaatcactgataaatcaccattgactgaaccatatttcaccagattcacc
gatgttaatggtaaaaaacaagctttagccaataatggttggatttggggaggtaatcca
ttagttgattttgcttcaaataaatcaaaggcatatattcgtcgagaagttattgtttgg
ggtgattgtgtcaaattgagatatggtgagaaatttgaagactcaccagaaacatggaaa
cgtatgattgaatatactcaattgtctgccaagactttcaatgggtttagaattgacaat
tgtcatagtaccccattacacgttggtgaaagattattagatgaagcaagaaaagttaat
cctaatctttatgtcattgctgaattgtttagtggttctgaagaaatggataaaattttt
gtcgaaagattagggatcaattcattgattagagaagcaatgcaagcatggagtgtaggt
gaattatctcgtttagttcataaacatggtggtagaccaattggttcgttgacttggtta
ccattagatgatttcacttatcctgctgctaatgaaccagtcaaggataaattcattgat
ggatataccgaattggaaattcctaaagtgttaacctgtcaagctcctcatgcaattttc
atggattgtactcatgataatgaaatgccagcacaaaagcgaactgttgaagatacatta
cctaatgcggcattagtagcattttgttcgtcggctattgggtcagtttttggttacgat
gaatgttatcctaaattgttgaatgttgtcagtgaaaccagacattatgatcttgatagt
gataatggtattggtaaggttaaagccaaattgaataaaattagagatgatcttgttcaa
gaaagtgaggacgtcacccgtgatcatgaaatgtatattcatcatgaaggacaatatatc
actattcaaagatataatgcaagaacaggtaacggttggtttttaattgccagaagcaaa
ttttctgatcatgagtctgcccaaggcttatcaccatcaatccttggtggcactaaagtg
aaacatcaatttagttacagtttgataagacaaccaggtgattatgaatcacaacaagat
aaattgacaggtattcctgtacaagttgaagctattcaaagtccatcgatcgaatacact
gatgatggtgattcaataattactattgatgaagcctcgttcattcctggatctattgct
gttttctccactgaaattcccggagttgatgtgaaattagacaattttgtgaaacaagga
gccattgaagcatcgattgggttagatttatacgatttgaatgccttattatatcgtgct
tccactgaagaattggatgctagtaatggcaaagatgatgtttatgatattccagggtat
ggaagattgacatatgctggattggaaggttggaatacagcattgaaacatgtcatttgg
caaaataatttgggtcatgcaatctgtgatcatttacgaaatggtgattgggcttttgat
tatgtggttaatcgattagataaatatgccgccaaactggaaaacttatcaaaattccaa
gattggttacgctctcgatttgatgctgttaaaaagagcaaagcgccatatttcttacga
ccacattattttgctcttattatgggtattgcttatgaagcagccagatttagagttatt
agacaaatgagtgatggaattaaagtggctactaattttgttcaaagtcttgctctcaca
tcggtgcaaatggtggggtatatgcaaaacacttctttagtaccagacaaacaagtgcca
tgtatggccgctgggttacctcatttcagtaatgattatatgagatgctggggtagagat
gttttcattgcctttagagggttattaattgtcactggaagatatgatgatgccaaacaa
catattttaggatttgccaagactttgaaacatgggttaattcctaatttattggatgct
ggacgtaatcctcgttataatgctagagatgcagcatggtttttcttacaagcgattcaa
gaatatgttacttatgctcctaatggtattgatattttggatgaaaaagtcactcgtaga
ttcccattggatgatacttatattccagttgatgatccccaagctttcagttatgaatct
tccattagagaaatcatttatgaaattttatcacgtcatgctaaaggtattaaataccgt
gaagccaatgcaggaccaaatttggattcacaaatgagagatgaagggttcaatgttgaa
gttggagttgattggaccaatgggttaatctatggtggtaatcaattcaattgtggtact
tggatggataaaatgggtgaaagtgaaaaagctcacaataaaggtatcccagggactcca
cgtgatggatcagcaattgaaattcaagggttattgaagagtgcattaagatttgttaat
aaattacacaaacaaggtaaatttgaatatactaaagttaccaaacctgatggctctact
atttcgttagaagattgggaatcattacttgctgaaaattttgaaaaacattattatgtt
cctaaagatccccaacaagatgatcaatatgttattgatccatcaattgttaatagaaga
ggaatttataaagatttgtataattcaggaaaaccatttgaagattatcaattacgacca
aattttgctattgccatgtgtgttgcccctgaattattcactccagaaaaagctcttggt
gccattataattgctgataaagctattcgaggacctattggtatgagaacattggatcca
tctgattggaattatcgaccatattatgaaaattccattgataatgatgattttgctact
tcaaaaggtagaaattatcatcaaggaccagaatgggtttggaatactggatatttctta
agagcatttttattattccatcatttagaagaagaatccagcaaagcatcttcatcactg
ccatcgattaagattttgacattattgaatgatagattacaaggacatataaaatggatt
aaagaaagtccatggaatggattaactgaattgactaataaagatggatcatattgtcaa
gattcaagtcctactcaagcatggagtggtagttgtttattagatttatattatgatctt
tggaatgataaacattttcaataa

DBGET integrated database retrieval system