KEGG   Candida albicans: CaO19.7466Help
Entry
CaO19.7466        CDS       T00189                                 

Gene name
ACC1
Definition
acetyl-CoA carboxylase; biotin carboxylase
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
cal  Candida albicans
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:cal00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    CaO19.7466 (ACC1)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CaO19.7466 (ACC1)
   00640 Propanoate metabolism
    CaO19.7466 (ACC1)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    CaO19.7466 (ACC1)
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    CaO19.7466 (ACC1)
Enzymes [BR:cal01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     CaO19.7466 (ACC1)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     CaO19.7466 (ACC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
R
AA seq 2271 aa AA seqDB search
MRCKLSLIKNTNSLVHRSRFLITKPQLYIPHRHYIPFKNIFKSLLMSDQSPSPSPSDSLS
YTTLHENLPSHFLGGNSVLNAEPSKVRDFVRAHQGHTVISKILIANNGIAAVKEIRSVRK
WAYETFGDEKAIQFTVMATPEDLEANAEYIRMADQFIEVPGGTNNNNYANVDLIVEIAES
TNAHAVWAGWGHASENPLLPEKLAASPKKIIFIGPPGSAMRSLGDKISSTIVAQHAQVPC
IPWSGTGVDEVKIDPQTNLVSVADDIYAKGCCTSPEDGLEKAKKIGFPVMIKASEGGGGK
GIRKVDDEKNFITLYNQAANEIPGSPIFIMKLAGDARHLEVQLLADQYGTNISLFGRDCS
VQRRHQKIIEEAPVTIARKETFHEMENAAVRLGKLVGYVSAGTVEYLYSHAEDKFYFLEL
NPRLQVEHPTTEMVTGVNLPAAQLQIAMGIPMHRIRDIRTLYGADPHTTTDIDFEFKSET
SLVSQRRPTPKGHCTACRITSEDPGEGFKPSGGSLHELNFRSSSNVWGYFSVGNQSSIHS
FSDSQFGHIFAFGENRQASRKHMVVALKELSIRGDFRTTVEYLIKLLETPDFEDNTITTG
WLDELITKKLTAERPDPIVAVVCGAVTKVHIQAEEEKKEYIQSLEKGQVPHRNLLKTIFP
VEFIYEGERYKFTATKSSEDKYTLFLNGSRCVVGARSLSDGGLLCALDGKSHSVYWKEEA
SATRLSVDGKTCLLEVENDPTQLRTPSPGKLVKYLVDSGEHVDAGQPYAEVEVMKMCMPL
IAQENGVVQLIKQPGSTVNAGDILAILALDDPSKVKHAKPFEGTLPSMGEPNVTGTKPAH
KFNHCAGILKNILAGYDNQVILNSTLKSLGEVLKDNELPYSEWQQQISALHSRLPPKLDD
GLTALVERTQSRGAEFPARQILKLITKSIAENGNDMLEDVVAPLVSIATSYQNGLVEHEY
DYFASLINEYYDVESLFSGENVREDNVILKLRDENKSDLKKVIGIGLSHSRVSAKNNLIL
AILDIYEPLLQSNSSVAASIREALKKLVQLDSRACAKVALKAREILIQCSLPSIKERSDQ
LEHILRSSVVQTSYGEIFAKHREPNLEIIREVVDSKHIVFDVLAQFLINPDPWVAIAAAE
VYVRRSYRAYDLGKIEYHVNDRLPIVEWKFKLANMGAAGVNDAQQAAAAGGDDSTSMKHA
ASVSDLTFVVDSKTEHSTRTGVLAPARHLDDVDETLTAALEQFQPADAISFKAKGETPEL
LNVLNIVITSIDGYSDENEYLSRINEILCEYKEELISAGVRRVTFVFAHQIGQYPKYYTF
TGPDYEENKVIRHIEPALAFQLELGRLANFDIKPIFTNNRNIHVYDAIGKNAPSDKRFFT
RGIIRTGVLKEDISISEYLIAESNRLMNDILDTLEVIDTSNSDLNHIFINFSNAFNVQAS
DVEAAFGSFLERFGRRLWRLRVTGAEIRIVCTDPQGTSFPLRAIINNVSGYVVKSELYLE
VKNPKGEWVFKSIGHPGSMHLRPISTPYPVKESLQPKRYKAHNMGTTYVYDFPELFRQAT
ISQWKKYGKKVPKDVFVSLELITDETDSLIAVERDPGANKIGMVGFKVTAKTPEYPHGRQ
LIIVANDITHKIGSFGPEEDNYFNKCTELARKLGIPRIYLSANSGARIGVAEELIPLYQV
AWNEEGSPDKGFRYLYLSTAAKESLEKDGKSDSVVTERIVEKGEERHVIKAIIGAEDGLG
VECLKGSGLIAGATSRAYKDIFTITLVTCRSVGIGAYLVRLGQRAIQIDGQPIILTGAPA
INKLLGREVYSSNLQLGGTQIMYNNGVSHLTANDDLAGVEKIMEWLSYVPAKRGLPVPIL
ESEDSWDRDVDYYPPKQEAFDVRWMIQGREVDGEYESGLFDKDSFQETLSGWAKGVVVGR
ARLGGIPIGVIGVETRTVENLIPADPANPDSTESLIQEAGQVWYPNSAFKTAQAINDFNN
GEQLPLMILANWRGFSGGQRDMYNEVLKYGSFIVDALVDFKQPIFTYIPPNGELRGGSWV
VVDPTINSDMMEMYADVDSRAGVLEPEGMVGIKYRRDKLLATMERLDPTYGEMKAKLNDS
SLSPEEHSKISAKLFAREKALLPIYAQISVQFADLHDRSGRMLAKGVIRKEIKWTDARRF
FFWRLRRRLNEEYVLRLISEQIKDSSKLERVARLKSWMPTVEYDDDQAVSNWIEENHAKL
QKRVNELKQEVSRTKIMRLLKEDPNSAISAMKDYVERLSKEDKEKFLKALK
NT seq 6816 nt NT seq  +upstreamnt  +downstreamnt
atgagatgcaaattatctctaataaagaatactaactcacttgtacatagatcgcgtttc
ctaattacaaaaccacaactatatatacctcatcgtcattatatcccattcaagaacata
ttcaagtcattgttaatgtcagatcaatctccatctcctagtcctagcgattcccttagc
tacactacattacatgaaaatttgccatctcatttcttgggtggaaattcagttttgaat
gctgaaccttctaaagtcagagactttgtcagagctcatcaaggtcatacagttatttcg
aaaattttaattgccaacaatggtatagctgcagttaaagaaatcagatcagttagaaaa
tgggcttatgaaacatttggtgacgaaaaagccatacagtttaccgttatggccactcca
gaagatttggaagctaatgccgaatatattagaatggccgaccaattcattgaagtccct
ggtggcaccaataacaataactatgctaatgttgatctcattgtagagatagcagaaagt
acaaatgctcatgccgtttgggctgggtgggggcatgcttcagagaatcctttgttacca
gaaaaattagctgcatctcccaaaaaaattatttttattggtcctcctggttcagctatg
agatctttaggtgacaagatttcatctactatagttgctcaacatgctcaagtaccatgt
attccatggtccggtactggtgttgatgaagtgaaaatagacccacaaactaatttggtt
tctgttgctgatgatatttatgccaaagggtgctgtactagtccagaagatggtttagaa
aaagccaaaaaaattgggttcccagttatgattaaagcctctgaaggtggtggtggtaaa
ggtattagaaaagttgatgatgagaaaaacttcattaccttatacaaccaagcagctaat
gaaataccaggttctcctatctttattatgaagttagcaggtgatgccagacatttagaa
gttcaattactagcagatcaatacggtactaacatttccctttttggaagagattgttcc
gtacaaagaagacaccaaaagattattgaagaagcaccagtcaccattgccagaaaggaa
actttccacgaaatggaaaatgcagcagtcagattgggtaaattagttggttatgtatct
gctggtactgttgagtatctttactcccacgctgaagataaattctactttttggaattg
aacccaagattgcaagttgaacatccaaccactgaaatggtgacaggtgttaatttacca
gctgctcaattacaaattgctatgggtataccaatgcatagaatcagagatatcagaact
ttgtacggtgccgatcctcataccactactgatattgattttgaattcaagtcagaaact
tcattggttagtcaaagaagaccaacaccaaagggacattgtactgcttgtcgtattact
tctgaagatcctggtgaaggttttaaaccaagtggtggttctttacatgaattgaatttc
cgttcttcttctaatgtgtggggttatttctcagttggtaaccaatcttctatccattca
ttttcggattctcaatttggtcatattttcgcatttggtgaaaaccgtcaagcttcaaga
aaacatatggttgttgccttgaaagaattgagtattagaggtgattttagaactactgtt
gagtatttaatcaaattgttagaaactccagatttcgaggataataccattacaactggt
tggttggatgaattaatcaccaaaaagttgactgctgaaagaccagatccaatagttgct
gttgtttgtggagctgtaaccaaagtacacatccaggctgaggaagagaaaaaggaatac
atccaatctttggaaaaaggtcaagttcctcacagaaacttattgaaaactattttccca
gttgagtttatttatgaaggtgaaagatacaagttcactgctactaaatcttcagaagat
aaatatactttgttccttaatggttctcgttgtgttgttggtgcacgttcattgtccgat
ggtggtttattgtgtgcattagatgggaaatcacattctgtctattggaaggaagaggca
tctgccactagattatcagttgatggcaaaacttgtttattagaagttgaaaatgatcca
acacaattaagaactccatctccaggtaaattggtcaagtatttggttgacagtggtgaa
catgttgatgctggtcaaccatacgctgaagtcgaagttatgaaaatgtgtatgcctttg
attgctcaagaaaatggggtagtgcagttgattaaacaaccgggttccacagttaatgct
ggtgatatcttggccattttggcattggacgatccatctaaggtcaaacatgctaaacca
tttgaaggtactttaccatctatgggtgagccaaatgttacaggtactaaaccagcacat
aaattcaatcattgtgctggtattttgaaaaacattttggctggttatgataatcaagtg
attttgaattctactttaaagagtcttggtgaagttttgaaagacaatgaattgccatac
tctgaatggcaacaacaaatttcagctttacactccagattgccacctaaattggatgac
ggattgactgcattggttgaaagaactcaaagtagaggtgctgaattccctgctcgtcaa
attttaaaactcatcaccaaatcaattgctgaaaatggtaatgatatgttagaagatgtt
gttgcaccattggtttctattgccacaagttaccagaatggtttggttgaacacgaatac
gattactttgcatctttgattaacgaatattatgacgttgaaagtttgttttcaggtgaa
aatgttagagaagataatgttatcttgaaattaagagatgaaaacaaatctgatttgaaa
aaagttattggtattggtttgtctcattcacgtgttagtgccaagaacaatttgatttta
gctattttggacatttatgaaccattgttgcaatccaactcgtcagttgctgcctctatc
agagaagctttaaagaaacttgttcaattagactctcgtgcttgtgccaaagttgcatta
aaggcaagagaaattttaattcaatgttctttaccttccatcaaggaaagatccgatcaa
ttggaacatattttgaggtcatctgttgttcaaacctcttatggtgaaatttttgctaaa
catagagaaccaaatttggaaattattcgtgaggttgttgattccaaacatattgttttt
gatgtgttggcacaattcttaatcaatccagacccatgggttgccattgctgccgctgaa
gtttatgtcagacgttcataccgtgcttatgatttgggtaaaattgaatatcatgttaat
gacagacttcctattgttgaatggaaattcaagttggctaatatgggagccgctggtgta
aacgatgctcaacaggctgctgctgccggtggcgatgattcgacatctatgaaacatgca
gcttctgtgtctgatttgacctttgttgttgattctaaaaccgagcattccacaagaact
ggtgttttagctccagcaagacacttggatgatgttgatgaaactcttacagctgcattg
gaacaattccaaccagccgatgctatttcatttaaagcaaagggtgaaactccagagtta
ttaaatgttttgaatattgtcattaccagtattgatggttactccgatgaaaatgaatac
ttgagcagaattaatgaaatcttgtgcgaatacaaagaagagttgatttctgctggtgtt
cgtcgtgttacatttgtttttgctcatcaaattggtcaatatcctaaatattatactttt
actggtcctgactatgaagaaaacaaggttattagacacattgaaccagctttggctttc
caattggaattgggaagattagccaatttcgatatcaaaccaattttcactaacaacaga
aacatccatgtatatgatgcaattgggaagaatgctccttctgataaaagatttttcacc
agagggattattagaaccggtgttcttaaagaagacattagcattagtgaatatttgatt
gctgaatccaacagattaatgaatgatattttggatactttagaagttattgacacttct
aattctgatttaaaccatattttcattaacttttccaatgctttcaatgttcaagcttca
gatgttgaggctgcctttggatcattcttagaaagatttggtagaagattatggagatta
agagttactggtgctgaaattagaattgtctgtactgatcctcaaggtacttcgttccca
ttgcgtgctatcattaataatgtttctggttatgttgtcaaatcagaattgtatttggaa
gtgaaaaatcctaaaggtgaatgggttttcaaatccattggtcatcctggttccatgcat
ttgagacctatctcaactccatatccagttaaagaatctttacaaccaaaacgttacaag
gctcacaatatgggtaccacttatgtgtatgacttcccagaattgtttcgtcaagcaaca
atttcacaatggaaaaaatatggcaaaaaagtaccaaaagatgttttcgtgtctttagaa
ttgatcactgatgaaactgattccttaatagctgttgaaagagatccgggtgctaacaaa
attggaatggttggattcaaagtcactgctaaaactcctgaataccctcatggtcgtcaa
ttaattattgttgccaatgatatcacccacaagattggttcttttggtccagaagaagat
aattatttcaacaagtgtactgaattggccagaaaattaggtattccaagaatttacctt
tctgcaaattcaggtgctagaattggtgttgctgaggaattgattccattataccaagtt
gcctggaatgaagaagggtctcctgacaaaggattcagatacttgtacttgagtactgct
gctaaagagtctttagaaaaagatggtaaaagtgacagtgttgttactgaacgtattgtt
gaaaaaggtgaagagcgtcatgtcattaaagctattattggtgccgaagatggcttaggg
gttgaatgtcttaaaggatcaggtttaattgctggtgccacatcaagagcttacaaggat
atatttaccatcactttggtaacttgtagatctgttggtattggtgcttatttggttaga
ttgggtcaaagagccattcaaatcgatggtcaacctattattttaactggtgctcctgct
atcaataaattgttgggtagagaagtgtattcttccaatcttcaattgggtggtactcaa
atcatgtacaataatggtgtttctcatttgacagctaatgatgatttggctggggttgaa
aaaattatggaatggttatcatatgttccagctaaacgtggtttaccagtgccaattttg
gaatcagaagattcttgggacagagatgttgattactacccaccaaaacaagaagctttt
gatgttagatggatgatccaaggtagagaagttgatggtgaatatgaatctgggttattt
gataaagattcattccaagaaacattatctggttgggctaaaggtgttgttgttggtaga
gcacgtttgggtggtattccaattggtgttattggtgtcgaaaccagaacagtggaaaac
ttgattcctgctgatccagcaaatccagactctacagaaagtttgattcaagaagcaggt
caagtgtggtatcctaactctgcttttaagacagcacaagctataaatgatttcaacaat
ggtgaacaattgccattaatgattttagcaaattggagaggtttctctggtggtcaaaga
gatatgtacaatgaagtcttgaaatatggttcatttattgttgatgctttagttgacttc
aagcaacctatcttcacttacattccaccaaatggagaattgagaggtggctcttgggtt
gttgttgatccaaccatcaactcagatatgatggaaatgtatgccgatgtcgattcgaga
gctggtgttttggaaccagaaggtatggttggtatcaaatacagacgtgataaattatta
gcaactatggaaagattagatccaacttatggtgaaatgaaagctaagttaaatgactcg
tcattatctccagaagaacactcgaaaataagcgccaaattgtttgcacgtgaaaaggct
ttattaccaatttatgctcaaatttccgttcaatttgctgacttgcacgatagatcaggt
cgtatgttggccaagggagttattagaaaggaaatcaaatggactgatgctagacgtttc
ttcttctggagattgagaagaagattgaacgaggaatatgttttgagattgattagtgaa
caaattaaagattctagcaaattggaaagagttgccagattgaagagttggatgccaact
gttgaatacgatgatgaccaagctgtcagtaactggattgaagagaaccatgccaaattg
caaaagagagttaatgaattgaaacaagaagtttcaagaaccaagattatgagattatta
aaagaggatccaaatagtgcaatttctgcaatgaaagactatgttgaaagattgtcaaaa
gaagataaagagaaattcctcaaggcattgaagtag

DBGET integrated database retrieval system