KEGG   Candida albicans: CAALFM_CR00230WAHelp
Entry
CAALFM_CR00230WA  CDS       T00189                                 

Gene name
CaO19.7511
Definition
(RefSeq) hypothetical protein
  KO
K14310  
nuclear pore complex protein Nup205
Organism
cal  Candida albicans
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:cal00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    CAALFM_CR00230WA (CaO19.7511)
Messenger RNA biogenesis [BR:cal03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     CAALFM_CR00230WA (CaO19.7511)
Chromosome [BR:cal03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    CAALFM_CR00230WA (CaO19.7511)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
R
AA seq 1847 aa AA seqDB search
MSGIFNWSSDVFADIYNTLKFESNIDLDTIDFTSIKNDLANVLITPVPSDQSRSKLGDAS
KPVALPSGDEVKLNQASIEITGVLSNELDLDELNTAELLYNASDLSYKKGTSIGDSARLA
YYLRAHYILNIVGYLVSHKRLDIITNNNQVLFDNILKSFSKIYTLSGKLNDMIDKQKVTG
DINNLAFINCINYSRSQLFNAHELLGQVVFGLADNYYESYGTLNNYKSLVEFISKNISDE
DVFVIHFLPSTLQLFKKLLQLGEESLVDQFYKTITSSILKDYEANNFSKSEDIDLSKSKL
SGFEIVTSFIFLTEFIPWCKQSSSRTAKYDFKDDILKYMEFLISYGVMERLLSYCSETAN
AKTQQVYDWSNMYDFRALLQKNFPRLTPAKFHYPGNQELLNAVRPGYENVSKLIDISFLT
LDPSLNETLVSPFFQSFFSVFISNAAVVMTSLRDSEEDFVLSSLNESDEEEEEEESDSDE
DSSTPKNKEKSTGLDLDKIAQRAELERFYLAFAYTYNNRPELCALFWGNEQVTHDIIGFI
SWGLANNTSPLITATFCLLLGSLASAGAEATSRIWEILVHNNNNASTRKNDFSKISVDSL
YDSLKYYIDSLNESFEQDLNAQLMLNQKKQDFLFSTTTSKQDLDDSGENRIVIELAEDSL
VFISGFIQLLSAIVKNLNTKNERSKEIKSVVYTRFSPIIKGFLKFDNLINGSRFLQVDAS
IQSTNNPKFIDLPNVFVSDDSRIILTNLILTFLGDFVTNDSDPYIRYEIWRLVDRWMYQG
LHSLPEDKKDDAFRHIKRKYISKKNVPINQAFSTNLTHLSQIGNFTVLVKKLLTPYADSN
EAFTKYSLLYPCDLGSGYRFNNQLGIWPYIEFLMQNVFANSATIANKRDRVNLQLNLLEL
FSNALQEVDWKFLIDVAPKIIRDLKNFNGIFDSLIPGVQLDFEVFVKLHHSVAVINYLFE
NKTFSALFKLVNIGVDSVNESGESAALVSHALGLINSLLRVQNSFINKLLPILRNKDTQQ
QLHCGTAIGIGTSMSLSLATPRTIFDCIYYPKNLGTHGVADFYEVILFHLSAVVQFALYV
SCENTISNKAISILKGVSQSKFFVTRVSSSADPLLNNDRLITTFENIDESIKIKFAFIDK
FEELEDSLNMKYEILDFVLGNLNQFDGKVATTAHFLLGYKVKGDTLDLVQTNDQNTLLKS
FLNTLSISLDLISEIDYNNGNNHIIDVGPAKLSSLILQILIKLCQDPISSSITLNQLREY
EELFEKLVNCQPKLDLNTVWCGNQFDGDLQIDASNVFVDNQASTQAFFSFINQRNLILQY
LSLEFHSVKSRTKREYYSKVLTNDKEFVNRTPKVLTFLNILNYSFKNFEVQKYEWLDQKF
NMSLLLAEVNAQKNGTLDFSVLTKVFRLLCQTSNLITPESKQLFAEEIMVEGSKISDFVT
KYSVSTDLKDVQLKCLHSWCQLIEILVTDSGINSSNFILEVLQVIIPKINDYFDVDISFS
EEMVSLCVLLFDLYDQSTLADRKGEDFALGIERLIPLFQTCIAGILNSNSTPSLRSDLYV
VGNKFLLKCFERESFLKQVMHIIKSVDKKFFQVICNDAIYSEGPSRITSTLFLESLVHLG
TLVKVDFILNALIKNNALSLLVRSVKRTDAMIKLCQEKNSGVTLDHFIFDLMAFKATLYF
FVRVAKSKNGALQLIQNELFSILHQSKFLQIDPDIGLSLRIEEVQDHKTVNVNVLLDTPL
SITDLVDPYKLRSENTISYFEFLVPIFQLLTTVLLSMGPNYQPAIIQTRELMKSVNRLVV
GVMKRDFLVETKQIGQGLYKEESHELVSLKELVKLFILIDSLAHYSV
NT seq 5544 nt NT seq  +upstreamnt  +downstreamnt
atgagtggcatatttaattggtcgctggatgtgtttgccgatatttataacaccctcaag
tttgagtccaatatagatttggatacaatcgacttcaccagcatcaagaatgatcttgca
aatgttttgattacaccagtccctctggatcaatcacgtagcaaacttggagacgcatca
aaaccagtggcgttgcccagtggagatgaggtgaaattgaatcaagcatcaattgaaatt
actggagttttatcaaatgaattggatttagatgaactaaatacagcagagttgttatat
aacgcaagtgacttgagctacaagaagggaacgtccattggcgatagtgctcgattggct
tattatttaagagctcattatatactaaacattgttggatacttagtttcgcataaacgt
ttagatatcatcactaacaacaaccaagtgttgtttgacaatattttgaaaagtttcagc
aagatttatactttgagtggtaaattaaatgacatgattgacaagcaaaaagttaccggc
gacatcaacaatcttgcatttatcaattgtatcaattattccagaagtcagttgtttaat
gcacacgagttattgggacaagttgtatttggattagcggataattattatgagagttat
ggcacactaaacaactataaatccttagtggagtttatactgaaaaatatcagcgatgaa
gatgtttttgttatccattttttaccatccactttacaattgttcaagaaattacttcaa
ctaggtgaggaatctttagtcgatcagttttacaagactataacctcttccatactaaaa
gattatgaagccaacaatttttccaaaagtgaagatattgacttgtcaaaatcaaaattg
tctggctttgaaatagtcacaagctttatttttctaactgagtttattccatggtgcaag
cagctgtcaagtagaaccgcgaaatacgatttcaaagatgatatattaaagtatatggaa
ttcttgataagttatggagttatggaacgattattatcgtactgttctgaaaccgccaat
gcaaaaactcagcaagtgtacgactggtcaaacatgtacgatttcagagcattgcttcaa
aagaatttcccacgacttacaccagcaaaatttcattatcctggcaatcaagaattgttg
aatgcagttagaccgggatatgaaaatgtatccaaattgattgacatttcctttttgacg
ttagatccatcgcttaatgagacgttggtttcaccttttttccagagctttttcagtgtg
tttatatctaatgcggcagttgttatgacctctttaagggactcagaggaagattttgtt
ttatcgtcgttgaatgaaagtgacgaagaggaagaagaagaagaaagcgacagcgacgaa
gattcttcgaccccaaaaaacaaagaaaaatcaactgggttagaccttgacaagattgcc
cagcgcgctgaattagaaaggttctacttggctttcgcgtacacctacaacaatagacct
gaattgtgtgcgttattttgggggaacgagcaggtaactcatgacattataggatttatt
tcctggggacttgctaataatacgtctccgttgatcactgcaacattctgcttactatta
gggtcgttggcatctgctggtgcagaggcaacttcaaggatatgggagattcttgtacac
aacaataacaacgcaagtacgagaaaaaatgatttttcaaagatatccgttgactccctt
tatgattcgttgaaatattacattgactctttaaatgaaagctttgaacaagatttaaat
gcccaattgatgttgaatcagaagaaacaagattttctcttcagcaccacaacaagcaaa
caggaccttgatgattctggcgagaatagaattgttatagagttggccgaggattcactt
gtcttcatttcagggtttattcaattactttctgcaattgtgaagaatttgaacactaag
aatgaaagaagcaaagaaatcaaatccgtggtatacactagattctcaccaatcattaaa
gggtttttaaaattcgataatttgatcaatggtagcaggttccttcaagttgatgctagc
attcaaagcacaaacaaccccaaatttattgatttgccaaatgttttcgtcagtgatgac
tcgagaattatattgacgaacctcattctaacctttttaggcgattttgttaccaacgat
agtgatccgtatattagatatgagatttggcgtttagtcgatcgatggatgtaccagggg
ttgcatagtttgccagaagataagaaagatgatgcttttagacatattaagagaaagtat
atcagtaagaaaaatgtccccatcaatcaagcattttcaacaaacctaactcatcttagt
cagattgggaatttcactgtcttggtgaaaaaattgttaaccccatacgcagatagtaat
gaagcattcaccaagtactcgttgttgtatccttgtgatttaggatcagggtatagattc
aacaaccaacttggaatttggccatacattgaatttttaatgcaaaatgtgtttgcaaac
tctgctactattgctaataaacgagatagggtcaacttgcaacttaatttgctagaatta
tttagcaatgcattacaggaagttgactggaagtttcttattgatgtggcaccgaaaatt
attcgtgacttgaaaaattttaatgggatatttgactcgcttattcctggtgttcaattg
gactttgaagtgtttgtcaaattgcatcattcagttgctgtgattaactatctatttgaa
aacaagacattttctgctttgtttaagcttgttaatattggagttgattctgtgaatgaa
tcaggtgaatcggctgcattagtgtcacatgcccttgggttgattaattctttgttgaga
gttcaaaattcttttataaacaagttgttaccaatattgcgaaacaaagatacgcagcaa
caattacattgtgggacagccattgggattggtacttctatgagtctttcgttagcaacc
cctagaaccatatttgattgtatatactatccaaagaacttgggaacacatggtgttgct
gatttctacgaagtgatattgttccacttatctgcagttgtccaatttgccctttatgtc
agttgtgaaaatactatttccaacaaagcaatttccatattgaaaggagtaagccaatcg
aaattttttgttaccagagtttcaagctctgctgatcccttactcaacaacgatagattg
attaccacatttgaaaacatcgacgagtcaataaaaatcaagtttgctttcattgacaag
tttgaagaactcgaggactctttgaatatgaaatatgagatattggattttgttttgggc
aatctcaatcaatttgatggcaaagtggctactactgcccactttttgttgggatacaaa
gtgaaaggcgatacattagacttggtacagacaaacgatcaaaacacattactaaaatct
ttcttaaatacattgagcattagtcttgatttaatttctgaaattgattacaataatggt
aataaccatattattgatgttggtccagccaagctttcgtcgttgattttacagattctt
atcaagttgtgccaagatccaatttcgtcgtcaataacattgaatcaattacgtgaatat
gaagaattgtttgaaaaattggttaactgtcaacctaaacttgatttgaataccgtttgg
tgtggtaaccagtttgatggggatttgcagattgatgctagcaatgtatttgttgacaac
caagcaagcacccaggctttcttttcctttattaaccagagaaacttaattttgcagtat
ttgtcattggaattccatagtgtcaaatcaagaactaagcgggagtattattctaaagtg
ttgaccaacgacaaggaatttgttaatcgtacacctaaggtgttgacatttttaaacatt
ctaaattattcattcaagaactttgaagtgcagaaatacgaatggcttgaccaaaaattt
aacatgtcgttgttattggcagaagtaaacgctcaaaagaatggtacattagatttttct
gttttaacaaaggttttccgtcttttgtgccaaacgtcaaacttaataacacccgagtca
aagcaattgtttgccgaagaaattatggttgaaggaagtaagatttctgactttgtcaca
aagtacctggtgtcgaccgacttgaaggatgtgcagttgaaatgcttacattcatggtgt
caattgatagagattttggttactgacagtggaatcaattcgctgaatttcatcttggaa
gtgttgcaagttattattcccaaaatcaatgactattttgatgtggacatactgttttct
gaagaaatggtttcattatgtgttttattgtttgatctttatgatcagctgactcttgcg
gacagaaaaggtgaagattttgcacttggaattgagagattgatccccttatttcagact
tgtattgcaggtattcttaattctaactcaacacccagcttacgctcagacttgtatgta
gttggcaacaagtttttgttaaaatgttttgagagagagtcgtttttgaaacaagtgatg
catatcatcaagtcggtagataaaaagtttttccaggtgatttgtaatgacgctatctac
tcagagggtccatctagaatcacttctactttattcctcgagtcattagttcacttaggg
actttggtcaaggttgattttattttgaatgcgttgatcaaaaataacgcattgctgttg
ctagtcaggtcagttaagcggactgatgccatgatcaaattgtgccaggaaaaaaattca
ggagtgactttagatcatttcatatttgacttgatggcattcaaagcaacgctatatttt
tttgttagagtggccaaatcgaaaaacggggcattgcagttgattcaaaatgaattgttt
tcaattttgcatcagtcgaagtttttgcagattgatccagatattggtttaagtttacga
attgaagaagttcaagatcacaagactgtcaatgtaaatgttttgctagatactccactt
tcgataactgacttggtggatccatacaagttgcgaagtgaaaacactatatcatatttt
gagttccttgtaccaatatttcagctacttacaacagtgttattgtcaatgggaccaaat
tatcaacctgcaattattcaaactagagaacttatgaagagtgtaaatcgattggtggta
ggtgttatgaaaagagatttcttggtagagaccaaacaaattggtcaagggttgtacaag
gaagagagtcacgagttggtatcgttgaaagaattggtgaagttgtttattttgattgat
tcattagctcattatagtgtgtag

DBGET integrated database retrieval system