KEGG   Candida albicans: CaO19.7511Help
Entry
CaO19.7511        CDS       T00189                                 

Gene name
NUP192
Definition
similar to S. cerevisiae NUP192 (YJL039C) large yeast nuclear pore complex subunit
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
cal  Candida albicans
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:cal00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    CaO19.7511 (NUP192)
Messenger RNA biogenesis [BR:cal03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     CaO19.7511 (NUP192)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
R
AA seq 1847 aa AA seqDB search
MSGIFNWSSDVFADIYNTLKFESNIDLDTIDFTSIKNDLANVLITPVPSDQSRSKLGDAS
KPVALPSGDEVKLNQASIEITGVLSNELDLDELNTAELLYNASDLSYKKGTSIGDSARLA
YYLRAHYILNIVGYLVSHKRLDIITNNNQVLFDNILKSFSKIYTLSGKLNDMIDKQKVTG
DINNLAFINCINYSRSQLFNAHELLGQVVFGLADNYYESYGTLNNYKSLVEFISKNISDE
DVFVIHFLPSTLQLFKKLLQLGEESLVDQFYKTITSSILKDYEANNFSKSEDIDLSKSKL
SGFEIVTSFIFLTEFIPWCKQSSSRTAKYDFKDDILKYMEFLISYGVMERLLSYCSETAN
AKTQQVYDWSNMYDFRALLQKNFPRLTPAKFHYPGNQELLNAVRPGYENVSKLIDISFLT
LDPSLNETLVSPFFQSFFSVFISNAAVVMTSLRDSEEDFVLSSLNESDEEEEEEESDSDE
DSSTPKNKEKSTGLDLDKIAQRAELERFYLAFAYTYNNRPELCALFWGNEQVTHDIIGFI
SWGLANNTSPLITATFCLLLGSLASAGAEATSRIWEILVHNNNNASTRKNDFSKISVDSL
YDSLKYYIDSLNESFEQDLNAQLMLNQKKQDFLFSTTTSKQDLDDSGENRIVIELAEDSL
VFISGFIQLLSAIVKNLNTKNERSKEIKSVVYTRFSPIIKGFLKFDNLINGSRFLQVDAS
IQSTNNPKFIDLPNVFVSDDSRIILTNLILTFLGDFVTNDSDPYIRYEIWRLVDRWMYQG
LHSLPEDKKDDAFRHIKRKYISKKNVPINQAFSTNLTHLSQIGNFTVLVKKLLTPYADSN
EAFTKYSLLYPCDLGSGYRFNNQLGIWPYIEFLMQNVFANSATIANKRDRVNLQLNLLEL
FSNALQEVDWKFLIDVAPKIIRDLKNFNGIFDSLIPGVQLDFEVFVKLHHSVAVINYLFE
NKTFSALFKLVNIGVDSVNESGESAALVSHALGLINSLLRVQNSFINKLLPILRNKDTQQ
QLHCGTAIGIGTSMSLSLATPRTIFDCIYYPKNLGTHGVADFYEVILFHLSAVVQFALYV
SCENTISNKAISILKGVSQSKFFVTRVSSSADPLLNNDRLITTFENIDESIKIKFAFIDK
FEELEDSLNMKYEILDFVLGNLNQFDGKVATTAHFLLGYKVKGDTLDLVQTNDQNTLLKS
FLNTLSISLDLISEIDYNNGNNHIIDVGPAKLSSLILQILIKLCQDPISSSITLNQLREY
EELFEKLVNCQPKLDLNTVWCGNQFDGDLQIDASNVFVDNQASTQAFFSFINQRNLILQY
LSLEFHSVKSRTKREYYSKVLTNDKEFVNRTPKVLTFLNILNYSFKNFEVQKYEWLDQKF
NMSLLLAEVNAQKNGTLDFSVLTKVFRLLCQTSNLITPESKQLFAEEIMVEGSKISDFVT
KYSVSTDLKDVQLKCLHSWCQLIEILVTDSGINSSNFILEVLQVIIPKINDYFDVDISFS
EEMVSLCVLLFDLYDQSTLADRKGEDFALGIERLIPLFQTCIAGILNSNSTPSLRSDLYV
VGNKFLLKCFERESFLKQVMHIIKSVDKKFFQVICNDAIYSEGPSRITSTLFLESLVHLG
TLVKVDFILNALIKNNALSLLVRSVKRTDAMIKLCQEKNSGVTLDHFIFDLMAFKATLYF
FVRVAKSKNGALQLIQNELFSILHQSKFLQIDPDIGLSLRIEEVQDHKTVNVNVLLDTPL
SITDLVDPYKLRSENTISYFEFLVPIFQLLTTVLLSMGPNYQPAIIQTRELMKSVNRLVV
GVMKRDFLVETKQIGQGLYKEESHELVSLKELVKLFILIDSLAHYSV
NT seq 5544 nt NT seq  +upstreamnt  +downstreamnt
atgagtggcatatttaattggtcgctggatgtgtttgccgatatttataacaccctcaag
tttgagtccaatatagatttggatacaatcgacttcaccagcatcaagaatgatcttgca
aatgttttgattacaccagtccctctggatcaatcacgtagcaaacttggagacgcatca
aaaccagtggcgttgcccagtggagatgaggtgaaattgaatcaagcatcaattgaaatt
actggagttttatcaaatgaattggatttagatgaactaaatacagcagagttgttatat
aacgcaagtgacttgagctacaagaagggaacgtccattggcgatagtgctcgattggct
tattatttaagagctcattatatactaaacattgttggatacttagtttcgcataaacgt
ttagatatcatcactaacaacaaccaagtgttgtttgacaatattttgaaaagtttcagc
aagatttatactttgagtggtaaattaaatgacatgattgacaagcaaaaagttaccggc
gacatcaacaatcttgcatttatcaattgtatcaattattccagaagtcagttgtttaat
gcacacgagttattgggacaagttgtatttggattagcggataattattatgagagttat
ggcacactaaacaactataaatccttagtggagtttatactgaaaaatatcagcgatgaa
gatgtttttgttatccattttttaccatccactttacaattgttcaagaaattacttcaa
ctaggtgaggaatctttagtcgatcagttttacaagactataacctcttccatactaaaa
gattatgaagccaacaatttttccaaaagtgaagatattgacttgtcaaaatcaaaattg
tctggctttgaaatagtcacaagctttatttttctaactgagtttattccatggtgcaag
cagctgtcaagtagaaccgcgaaatacgatttcaaagatgatatattaaagtatatggaa
ttcttgataagttatggagttatggaacgattattatcgtactgttctgaaaccgccaat
gcaaaaactcagcaagtgtacgactggtcaaacatgtacgatttcagagcattgcttcaa
aagaatttcccacgacttacaccagcaaaatttcattatcctggcaatcaagaattgttg
aatgcagttagaccgggatatgaaaatgtatccaaattgattgacatttcctttttgacg
ttagatccatcgcttaatgagacgttggtttcaccttttttccagagctttttcagtgtg
tttatatctaatgcggcagttgttatgacctctttaagggactcagaggaagattttgtt
ttatcgtcgttgaatgaaagtgacgaagaggaagaagaagaagaaagcgacagcgacgaa
gattcttcgaccccaaaaaacaaagaaaaatcaactgggttagaccttgacaagattgcc
cagcgcgctgaattagaaaggttctacttggctttcgcgtacacctacaacaatagacct
gaattgtgtgcgttattttgggggaacgagcaggtaactcatgacattataggatttatt
tcctggggacttgctaataatacgtctccgttgatcactgcaacattctgcttactatta
gggtcgttggcatctgctggtgcagaggcaacttcaaggatatgggagattcttgtacac
aacaataacaacgcaagtacgagaaaaaatgatttttcaaagatatccgttgactccctt
tatgattcgttgaaatattacattgactctttaaatgaaagctttgaacaagatttaaat
gcccaattgatgttgaatcagaagaaacaagattttctcttcagcaccacaacaagcaaa
caggaccttgatgattctggcgagaatagaattgttatagagttggccgaggattcactt
gtcttcatttcagggtttattcaattactttctgcaattgtgaagaatttgaacactaag
aatgaaagaagcaaagaaatcaaatccgtggtatacactagattctcaccaatcattaaa
gggtttttaaaattcgataatttgatcaatggtagcaggttccttcaagttgatgctagc
attcaaagcacaaacaaccccaaatttattgatttgccaaatgttttcgtcagtgatgac
tcgagaattatattgacgaacctcattctaacctttttaggcgattttgttaccaacgat
agtgatccgtatattagatatgagatttggcgtttagtcgatcgatggatgtaccagggg
ttgcatagtttgccagaagataagaaagatgatgcttttagacatattaagagaaagtat
atcagtaagaaaaatgtccccatcaatcaagcattttcaacaaacctaactcatcttagt
cagattgggaatttcactgtcttggtgaaaaaattgttaaccccatacgcagatagtaat
gaagcattcaccaagtactcgttgttgtatccttgtgatttaggatcagggtatagattc
aacaaccaacttggaatttggccatacattgaatttttaatgcaaaatgtgtttgcaaac
tctgctactattgctaataaacgagatagggtcaacttgcaacttaatttgctagaatta
tttagcaatgcattacaggaagttgactggaagtttcttattgatgtggcaccgaaaatt
attcgtgacttgaaaaattttaatgggatatttgactcgcttattcctggtgttcaattg
gactttgaagtgtttgtcaaattgcatcattcagttgctgtgattaactatctatttgaa
aacaagacattttctgctttgtttaagcttgttaatattggagttgattctgtgaatgaa
tcaggtgaatcggctgcattagtgtcacatgcccttgggttgattaattctttgttgaga
gttcaaaattcttttataaacaagttgttaccaatattgcgaaacaaagatacgcagcaa
caattacattgtgggacagccattgggattggtacttctatgagtctttcgttagcaacc
cctagaaccatatttgattgtatatactatccaaagaacttgggaacacatggtgttgct
gatttctacgaagtgatattgttccacttatctgcagttgtccaatttgccctttatgtc
agttgtgaaaatactatttccaacaaagcaatttccatattgaaaggagtaagccaatcg
aaattttttgttaccagagtttcaagctctgctgatcccttactcaacaacgatagattg
attaccacatttgaaaacatcgacgagtcaataaaaatcaagtttgctttcattgacaag
tttgaagaactcgaggactctttgaatatgaaatatgagatattggattttgttttgggc
aatctcaatcaatttgatggcaaagtggctactactgcccactttttgttgggatacaaa
gtgaaaggcgatacattagacttggtacagacaaacgatcaaaacacattactaaaatct
ttcttaaatacattgagcattagtcttgatttaatttctgaaattgattacaataatggt
aataaccatattattgatgttggtccagccaagctttcgtcgttgattttacagattctt
atcaagttgtgccaagatccaatttcgtcgtcaataacattgaatcaattacgtgaatat
gaagaattgtttgaaaaattggttaactgtcaacctaaacttgatttgaataccgtttgg
tgtggtaaccagtttgatggggatttgcagattgatgctagcaatgtatttgttgacaac
caagcaagcacccaggctttcttttcctttattaaccagagaaacttaattttgcagtat
ttgtcattggaattccatagtgtcaaatcaagaactaagcgggagtattattctaaagtg
ttgaccaacgacaaggaatttgttaatcgtacacctaaggtgttgacatttttaaacatt
ctaaattattcattcaagaactttgaagtgcagaaatacgaatggcttgaccaaaaattt
aacatgtcgttgttattggcagaagtaaacgctcaaaagaatggtacattagatttttct
gttttaacaaaggttttccgtcttttgtgccaaacgtcaaacttaataacacccgagtca
aagcaattgtttgccgaagaaattatggttgaaggaagtaagatttctgactttgtcaca
aagtacctggtgtcgaccgacttgaaggatgtgcagttgaaatgcttacattcatggtgt
caattgatagagattttggttactgacagtggaatcaattcgctgaatttcatcttggaa
gtgttgcaagttattattcccaaaatcaatgactattttgatgtggacatactgttttct
gaagaaatggtttcattatgtgttttattgtttgatctttatgatcagctgactcttgcg
gacagaaaaggtgaagattttgcacttggaattgagagattgatccccttatttcagact
tgtattgcaggtattcttaattctaactcaacacccagcttacgctcagacttgtatgta
gttggcaacaagtttttgttaaaatgttttgagagagagtcgtttttgaaacaagtgatg
catatcatcaagtcggtagataaaaagtttttccaggtgatttgtaatgacgctatctac
tcagagggtccatctagaatcacttctactttattcctcgagtcattagttcacttaggg
actttggtcaaggttgattttattttgaatgcgttgatcaaaaataacgcattgctgttg
ctagtcaggtcagttaagcggactgatgccatgatcaaattgtgccaggaaaaaaattca
ggagtgactttagatcatttcatatttgacttgatggcattcaaagcaacgctatatttt
tttgttagagtggccaaatcgaaaaacggggcattgcagttgattcaaaatgaattgttt
tcaattttgcatcagtcgaagtttttgcagattgatccagatattggtttaagtttacga
attgaagaagttcaagatcacaagactgtcaatgtaaatgttttgctagatactccactt
tcgataactgacttggtggatccatacaagttgcgaagtgaaaacactatatcatatttt
gagttccttgtaccaatatttcagctacttacaacagtgttattgtcaatgggaccaaat
tatcaacctgcaattattcaaactagagaacttatgaagagtgtaaatcgattggtggta
ggtgttatgaaaagagatttcttggtagagaccaaacaaattggtcaagggttgtacaag
gaagagagtcacgagttggtatcgttgaaagaattggtgaagttgtttattttgattgat
tcattagctcattatagtgtgtag

DBGET integrated database retrieval system