KEGG   Candida albicans: CaO19.7516Help
Entry
CaO19.7516        CDS       T00189                                 

Gene name
BGL97
Definition
potential glucosidase similar to bacterial beta-glucosidases; similar to potential fungal beta-glucosidases AN1416.2, MG00621.4, NCU04726.1
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
cal  Candida albicans
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:cal00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CaO19.7516 (BGL97)
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    CaO19.7516 (BGL97)
Enzymes [BR:cal01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     CaO19.7516 (BGL97)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
R
AA seq 963 aa AA seqDB search
MSTFYAGQLLCGGFQGTTVTPQAYHLIVEHHVSAMILSRKNAFNVEQMTKLIKDLQYIAM
TEGRYKYPIMFAIDEEGGMMNSLFDPDFLTQYPGAMALAATGDPQLVYEISRAIAIEIKK
IGFSIILGPVLDVVTKLSHQLVGVRSFGTTIEDVVKYGRMCAQGLQDGGLFTVGKHFPGI
GNATVDSLLELPMMGDSLEQLRHFNVVPFEMLINEGLLDGISAAGCGVPNISPDETHACL
SPVVINQLLRQELNFDGFVISECLEMEALYHSVGLGQGVILAINAGCDLVMVCHDMELQN
EAIDSIKTAVVNGNLDEETVLKSLKRINKLQTRLPSWTQLFPEGEVSAKLPPTLFRNECP
VVWEQHQKLSSLAYKKSITLIRDFDGTLPIPKHLSARGSDQIDSILLLTPLLNPIYPCKQ
TGSSQRLFTGEEVFQKFGDFLSNHPINKTKSYNVLHTTYTANGLTPLHESLIEQSKIVIF
LTSEAGRNMYQIGIVKYVSILCGVNPLTLTKGLGPVQPRKPLIIVATSSPYDFFYNKSIG
SAYLCCYDYTNNALENLASLLMGDFEAQGCVPGEKKFSTKHKKSAVEGRNENNHLSAKSV
HKPKRRWLVDEFSMERDWQGLTKLLKTNSDQLTNDGFYKRLEGLLSSTAKHQKHFVVRNS
SLNILYGIVLTWVNESNCGHLVYILVEKSKRLQSIGKNLHLRAIRYLIKERKCNEIVLGS
SFPLISLGGNNNKPFFKGVGWNTQVSTEKSVMLLQNLDSWSVPQNILQEIMIVGVRFDIC
SDTSKLMKMMERCLSSEAYDAREYKNVKSLYSEAQKYLKINSPYEVKIILALEPTTQNVI
GSIVIFTSNSQLSKFYPFIDVFGEENDSPGNRSIIGAIAGPVIDPSYSNLTEIFKYGLIC
SAITFLKTSLSEDNIKSCIMTDMGTEDKAMRGVKEIGFNVWKPYHDNYGYNSVNSNVESK
FGL
NT seq 2892 nt NT seq  +upstreamnt  +downstreamnt
atgtccacattttatgctggacaattattatgtggaggatttcaaggtaccaccgttacc
cctcaagcgtatcatttaattgttgaacaccatgtatcggccatgatattatcgcggaaa
aatgcctttaatgtggagcagatgacgaaattgatcaaagaccttcagtatattgccatg
acagagggcaggtacaagtatccaatcatgtttgccatagatgaggaaggtgggatgatg
aactcgttgtttgaccccgacttcttaactcagtaccctggggcgatggcgctagcagcg
acaggtgatcctcaattggtgtatgagattctgagagctatagctattgaaataaagaaa
atagggttttctataattttaggtcccgtgttagatgttgtgacaaaactatcacatcag
ttggtgggagttaggagttttggaaccaccattgaagatgtggttaaatatggacgtatg
tgtgcccaagggttacaggatggagggttgtttaccgtggggaaacatttcccaggtatt
ggaaacgctactgttgactcattactagaactacccatgatgggtgactcgttagaacaa
ttgaggcattttaatgttgtgccatttgaaatgttgatcaatgaagggttgttagatgga
ataagtgctgctgggtgtggtgtgcccaatattagccccgacgaaacgcatgcatgtctc
tccccagttgtgattaaccagttgctacgacaagaattgaactttgatgggtttgttatt
agtgagtgtttagagatggaagctctttaccattctgtggggttaggccaaggggtgatt
ttggcaatcaatgccggctgcgatttggtgatggtgtgtcatgacatggaattgcaaaac
gaagctattgactcaattaaaacggccgtggtaaacgggaatttggacgaagaaacagta
ctaaaaagtttgaagcgaataaataaattgcagacaagattgccgagctggacacaactt
ttccctgaaggtgaagtatcagccaagttaccaccaactttgtttagaaacgaatgtccc
gtggtgtgggagcagcatcagaaactttcgtcattggcttataagaaatcaatcacattg
atacgtgattttgatggaactttacctatcccaaagcatttaagtgctagaggtagcgac
caaattgactctattttgttgctaacgccattactaaacccgatatacccgtgtaaacaa
acagggtcaagtcaacggttgtttactggagaggaggtgtttcagaaattcggcgacttt
ttatctaaccatccaatcaacaaaacaaaatcatacaatgtccttcacacaacatacact
gctaacggattgacaccgctacatgaatcgttaattgaacaatctaaaatagttattttt
ctcactagtgaagcgggaagaaacatgtaccaaattggtattgtaaagtatgtttccata
ttgtgcggagtcaacccgttgactttgactaaagggttgggtccagttcagccaagaaag
ccattaattatagttgccacgctgtcgccatacgatttcttttacaacaagagtattgga
agcgcatatttgtgttgctacgactacacaaataatgctttagaaaacttggcatctttg
ttgatgggggattttgaagcccaaggatgtgttcctggagaaaagaagttttcgacaaag
cacaagaaactggcggtggaaggtagaaatgaaaataaccacttgagtgcaaaatcagtg
cataaacctaaaaggagatggttggttgacgagtttctgatggaaagagactggcaaggt
ttaaccaagttattgaaaacaaacagtgatcaacttacaaacgatgggttttataaaagg
ctcgaagggttgttgagctccacagcgaaacatcaaaagcattttgttgttcgtaactcg
tctttgaatatcttgtatgggattgttttgacatgggtcaatgaatcaaattgcggacat
cttgtgtacatattggttgaaaaatcaaaacgtttgcagagtattgggaaaaacttacac
ctcagagcaatacgatatttgataaaggagaggaaatgtaatgaaattgtattaggtagc
tcgttcccgttgatttcacttggtggtaacaacaataaaccattttttaaaggtgtgggc
tggaacacacaagtttctacggagaagagtgtcatgcttttgcaaaatttggatagctgg
ctggtgccacagaatattttgcaagaaatcatgattgttggtgtaaggtttgatatctgt
tctgatacaagtaaattaatgaaaatgatggaaagatgtttgctgtcagaagcatacgat
gcaagagagtataaaaatgtcaagagtctatacagtgaggcacaaaaatacctcaagatc
aattctccttacgaagtaaagattattcttgcccttgaaccaaccacacaaaatgtcatt
ggaagtattgtgatatttactagcaattcccaattgtcaaagttttatccgtttattgat
gtgtttggagaagaaaatgacagccctggaaacagatcgataattggtgcgattgctggt
cctgttattgatccactgtattccaatttaacagagatttttaagtatgggttaatttgc
agtgcaattacgtttttgaaaacatctttgagtgaggataatataaagagttgtataatg
accgatatgggtactgaagataaggctatgcgtggagttaaagagataggatttaatgtt
tggaagccttatcacgataattacggatataatagtgtaaatagtaatgtagagagtaag
tttggattgtga

DBGET integrated database retrieval system