KEGG   Candida albicans: CaO19.7523Help
Entry
CaO19.7523        CDS       T00189                                 

Gene name
MKC1
Definition
MAP kinase implicated in PKC1-controlled signalling pathway; similar to S. cerevisiae SLT2 (YHR030C) MAP kinase; role in construction of C. albicans cell wall
Orthology
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
cal  Candida albicans
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:cal00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    CaO19.7523 (MKC1)
Enzymes [BR:cal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     CaO19.7523 (MKC1)
Protein kinases [BR:cal01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   CaO19.7523 (MKC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
R
AA seq 509 aa AA seqDB search
MDQQEAPIYYGRSVNKVYNQEFIIDSRFKIVKELGHGAYGIVCSAKYDNGSKKVPDSNNG
NASSSANASFVAIKKITNIFSKNILCKRALRELKLLQFFRGHKNITCLYDLDIIPNPMTG
EFNEIYLYEELMECDMHQIIRSGQPLSDQHYQSFIYQVLCGLNFIHSADVLHRDLKPGNL
LVNADCELKICDFGLARGFSENPDENAGFMTEYVATRWYRAPEIMLSFTNYTKAIDIWSV
GCILAELLGGKPLFRGKDYVDQLNQILMILGTPPESTLQRIGSHRAQNYVRSLPITRKAS
YEELFPDANPLALDLLERMLTLDPRERITVRDALNHKYLELWHDPKEEIECQVKFDFKSF
ETVDGLDEMKQLIMDEVQKFREFVRKPIEEQQRIQMQLHMQKREEQRQEEEEKELLEQQR
QFPAQESMDISQTPYNNLETNIGTPQVEDDYPRPQELDEFTFSNLESSSSMNLFQDMAKP
SGEEYIKLEEELGFGLDGAMFNNYCNDHQ
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atggatcaacaagaagcacccatatattatggcagatccgtaaataaggtctacaaccag
gaatttatcattgatagtcgattcaaaatagtcaaggagttgggccatggtgcctatggt
attgtgtgttcagcaaaatacgataatgggtccaaaaaggttcctgattcaaacaacggt
aatgcctcatcttcagctaatgcatcgtttgtggcaatcaaaaagatcactaatattttc
agcaaaaacatcttatgtaaacgtgctttgcgtgaattgaagttgttgcagttcttcagg
ggccataaaaatataacatgtttatatgatttggacattatccccaatcccatgacaggc
gagtttaatgaaatatatttatacgaagaattaatggaatgtgacatgcaccaaatcatt
agatctggacaaccattgtccgatcagcactaccagtcgtttatttatcaggtattgtgt
ggattgaacttcatccattcggctgatgtgttgcatcgtgatttgaaaccaggtaactta
cttgtcaatgccgactgtgagcttaaaatttgtgactttggtttagcaagagggttttct
gagaaccccgacgaaaatgctgggtttatgacagagtatgttgccaccagatggtacagg
gcaccagaaattatgttgagtttcaccaactacactaaggcaatcgacatctggtctgtt
ggttgtatattggcagaacttttggggggcaagccacttttccgtggcaaagattacgta
gatcaacttaatcagattttaatgatattaggtaccccaccagaatccacgttacaaaga
atagggtcccacagagcccagaactatgtcagatctttgccgattacgagaaaagctagc
tacgaagaacttttccctgacgccaacccgttggcgttggatttattggaaagaatgttg
actttagacccacgtgagagaattacagttcgagatgcattgaatcataagtacttagag
ctttggcatgatcctaaagaagaaattgagtgccaagtcaaatttgatttcaagtcgttt
gagactgtagatgggttggacgaaatgaaacagttgatcatggatgaagttcagaagttt
cgtgaatttgtgaggaagccaattgaggaacagcagcgaatacaaatgcagctacatatg
caaaaacgtgaagaacagcgacaagaggaggaagagaaagagctactagaacagcaaaga
cagtttccagctcaagagagtatggatatttctcagaccccttacaataacttggaaacg
aatataggtactcctcaggttgaagatgattatcccagaccacaagagttggatgagttt
actttttcaaatttggaatcttcaagctccatgaatttgttccaagacatggctaaacca
tcaggagaagagtatataaagctagaggaagagcttgggtttggattagatggtgctatg
tttaacaactactgtaacgaccaccagtag

DBGET integrated database retrieval system