KEGG   Candida albicans: CaO19.7613Help
Entry
CaO19.7613        CDS       T00189                                 

Gene name
HCR1
Definition
High Copy suppressor of RPG1
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
cal  Candida albicans
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:cal03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
R
AA seq 285 aa AA seqDB search
MSWDDEDFDIPSNSKKTVAASWEDEEDDGPVLESWDVDPEEEEKKKKEAKLQEAKRKAEL
KAKEDAEKAKKDAKRKELEQFDQLDERTRKELLKKAELNADLNNAADLFGGLGVADDNDD
DDFDINEHPRERITKQQLAAAAASKRPALTKDTPLEEHPLFQPTNKQEYEKLRKTVGTSL
TRLNEDSSLLYASSLAVDLIRDLSQPLSVENLRKVISTLNVVIKDKERQERQARLKKAGG
TATGGAGKKKAKPLARPNVGGGFKKDAFDDMDDGQFDDLDDDDFM
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgagttgggacgacgaagattttgatattccatctaatagtaaaaaaaccgttgctgca
tcttgggaagatgaggaagatgatggtccagtcttagaatcatgggatgtcgatcctgaa
gaagaagaaaagaagaaaaaggaagcaaaattgcaagaggctaaaagaaaagctgaatta
aaagccaaagaggatgccgaaaaggcgaaaaaagacgccaaaagaaaagaattagagcaa
tttgatcaattagatgaaagaactcgtaaggaattgttgaaaaaagctgaattgaatgcc
gatttgaacaatgctgctgatttgtttggaggattgggcgtcgccgacgataatgacgat
gatgatttcgatatcaatgaacatccaagagaaagaataaccaaacaacaattagctgct
gctgctgctagtaagagaccagcattaactaaggatacacctttggaagaacatccattg
tttcaacctacaaacaaacaagaatatgaaaaattaagaaagactgttggtacttcattg
acaagattaaatgaagactcttcgttgttatatgcatctagtttggccgttgatttgata
agagacttgtcacagccattatcagtggaaaaccttaggaaagtcataagcacattaaat
gtggtgatcaaagacaaagaaagacaagaaagacaagcaagattaaagaaggctggtggt
actgctactggtggggccggtaagaagaaggccaagcctcttgccagaccaaatgtgggt
ggcgggttcaaaaaggatgcctttgatgatatggatgatggtcaatttgatgatttagat
gacgatgattttatgtaa

DBGET integrated database retrieval system