KEGG   Candida albicans: CaO19.7613Help
Entry
CaO19.7613        CDS       T00189                                 

Gene name
HCR1
Definition
High Copy suppressor of RPG1
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
cal  Candida albicans
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:cal00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    CaO19.7613 (HCR1)
Translation factors [BR:cal03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    CaO19.7613 (HCR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
R
AA seq 285 aa AA seqDB search
MSWDDEDFDIPSNSKKTVAASWEDEEDDGPVLESWDVDPEEEEKKKKEAKLQEAKRKAEL
KAKEDAEKAKKDAKRKELEQFDQLDERTRKELLKKAELNADLNNAADLFGGLGVADDNDD
DDFDINEHPRERITKQQLAAAAASKRPALTKDTPLEEHPLFQPTNKQEYEKLRKTVGTSL
TRLNEDSSLLYASSLAVDLIRDLSQPLSVENLRKVISTLNVVIKDKERQERQARLKKAGG
TATGGAGKKKAKPLARPNVGGGFKKDAFDDMDDGQFDDLDDDDFM
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgagttgggacgacgaagattttgatattccatctaatagtaaaaaaaccgttgctgca
tcttgggaagatgaggaagatgatggtccagtcttagaatcatgggatgtcgatcctgaa
gaagaagaaaagaagaaaaaggaagcaaaattgcaagaggctaaaagaaaagctgaatta
aaagccaaagaggatgccgaaaaggcgaaaaaagacgccaaaagaaaagaattagagcaa
tttgatcaattagatgaaagaactcgtaaggaattgttgaaaaaagctgaattgaatgcc
gatttgaacaatgctgctgatttgtttggaggattgggcgtcgccgacgataatgacgat
gatgatttcgatatcaatgaacatccaagagaaagaataaccaaacaacaattagctgct
gctgctgctagtaagagaccagcattaactaaggatacacctttggaagaacatccattg
tttcaacctacaaacaaacaagaatatgaaaaattaagaaagactgttggtacttcattg
acaagattaaatgaagactcttcgttgttatatgcatctagtttggccgttgatttgata
agagacttgtcacagccattatcagtggaaaaccttaggaaagtcataagcacattaaat
gtggtgatcaaagacaaagaaagacaagaaagacaagcaagattaaagaaggctggtggt
actgctactggtggggccggtaagaagaaggccaagcctcttgccagaccaaatgtgggt
ggcgggttcaaaaaggatgcctttgatgatatggatgatggtcaatttgatgatttagat
gacgatgattttatgtaa

DBGET integrated database retrieval system