KEGG   Candida albicans: CaO19.7626Help
Entry
CaO19.7626        CDS       T00189                                 

Gene name
CDC33
Definition
mRNA cap-binding protein eIF4E, translation initiation; similar to S. cerevisiae CDC33 (YOL139C)
Orthology
K03259  
translation initiation factor 4E
Organism
cal  Candida albicans
Pathway
RNA transport
Module
eIF4F complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:cal03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
R
AA seq 209 aa AA seqDB search
MSEELAQKTEELSLDSKTVFDSKEEFNAKHPLNSRWTLWYTKPQTNKSENWHDLLKPVIT
FSSVEEFWGIYNSIPPANQLPLKSDYHLFKEGIRPEWEDEANSKGGKWQFSFNKKSEVNP
IINDLWLRGLLAVIGETIEDEENEVNGIVLNIRKQAYRVGIWTKDCDESKLKTVGERLKK
VLQLNDEQKVEFMSHDASNTRGAEPQIVL
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaagaattagctcaaaaaactgaagaattgtcattagattccaagactgttttt
gattccaaagaagaatttaatgcaaagcatccattgaacagtagatggacattatggtac
actaaaccacaaaccaacaagagtgaaaactggcatgatttattaaagccagttataact
ttctcatctgttgaagaattttggggaatttacaactcgattccaccagcaaatcaatta
cctttgaaatcagattatcatttgttcaaagaaggaattagaccggaatgggaagatgag
gctaactcaaaaggtggtaaatggcaattctccttcaacaaaaaactggaagtcaatcca
atcataaatgatttgtggttaagaggtttgttggcagttattggtgaaaccattgaggat
gaagaaaacgaagtcaatgggattgtgttgaatatcagaaagcaagcttacagagtcggt
atttggaccaaagattgtgatgaatccaaattaaagactgtcggtgagagattgaagaaa
gtcttgcaattaaacgatgaacaaaaagttgaattcatgtcgcatgatgcttccaatact
agaggcgctgaacctcaaattgttttgtaa

DBGET integrated database retrieval system