KEGG   Candida albicans: CaO19.7626Help
Entry
CaO19.7626        CDS       T00189                                 

Gene name
CDC33
Definition
mRNA cap-binding protein eIF4E, translation initiation; similar to S. cerevisiae CDC33 (YOL139C)
Orthology
K03259  
translation initiation factor 4E
Organism
cal  Candida albicans
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:cal00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    CaO19.7626 (CDC33)
Messenger RNA biogenesis [BR:cal03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     CaO19.7626 (CDC33)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     CaO19.7626 (CDC33)
Translation factors [BR:cal03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    CaO19.7626 (CDC33)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
R
AA seq 209 aa AA seqDB search
MSEELAQKTEELSLDSKTVFDSKEEFNAKHPLNSRWTLWYTKPQTNKSENWHDLLKPVIT
FSSVEEFWGIYNSIPPANQLPLKSDYHLFKEGIRPEWEDEANSKGGKWQFSFNKKSEVNP
IINDLWLRGLLAVIGETIEDEENEVNGIVLNIRKQAYRVGIWTKDCDESKLKTVGERLKK
VLQLNDEQKVEFMSHDASNTRGAEPQIVL
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaagaattagctcaaaaaactgaagaattgtcattagattccaagactgttttt
gattccaaagaagaatttaatgcaaagcatccattgaacagtagatggacattatggtac
actaaaccacaaaccaacaagagtgaaaactggcatgatttattaaagccagttataact
ttctcatctgttgaagaattttggggaatttacaactcgattccaccagcaaatcaatta
cctttgaaatcagattatcatttgttcaaagaaggaattagaccggaatgggaagatgag
gctaactcaaaaggtggtaaatggcaattctccttcaacaaaaaactggaagtcaatcca
atcataaatgatttgtggttaagaggtttgttggcagttattggtgaaaccattgaggat
gaagaaaacgaagtcaatgggattgtgttgaatatcagaaagcaagcttacagagtcggt
atttggaccaaagattgtgatgaatccaaattaaagactgtcggtgagagattgaagaaa
gtcttgcaattaaacgatgaacaaaaagttgaattcatgtcgcatgatgcttccaatact
agaggcgctgaacctcaaattgttttgtaa

DBGET integrated database retrieval system