KEGG   Candida albicans: CaO19.7638Help
Entry
CaO19.7638        CDS       T00189                                 

Gene name
PRO1
Definition
gamma-glutamyl kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
cal  Candida albicans
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:cal00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CaO19.7638 (PRO1)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    CaO19.7638 (PRO1)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    CaO19.7638 (PRO1)
Enzymes [BR:cal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     CaO19.7638 (PRO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
R
AA seq 423 aa AA seqDB search
MTKQFTIVIKLGTSSLVDEVTREPRIANMSLIVETMVRLRRQGHKIVIVSSGAIACGMKQ
VGLEEKPANLSAVQALASIGQVRLIRTFDDLFRQLEQPIAQILLTRNDIMDFTQYKNAQN
TLNELMDMGIIPIVNENDTLSVSEIKFGDNDSLSAITAGIIHADYLFLMTDVECLYTDNP
RTNPDAQPILVVDKIDDLHVKTDTESGAGSKVGTGGMTTKLIAADLATNAGVTTIITLSS
QPYYIIDIVAHIQAHADTLSVENQRLALQKDIQQGKIPLHTRFLSKPQDTLIKSDRRFWL
LHGLKTKGALVIDQGCFQALTRRNRAGLLPVGILHVVGNFHQSECVSIKVVPDKNGAIDD
AVEVGHCRVNYSAPEITLIKGHKSSEIEAILGYADSEYVAHRDNLAFPPVMPPSTDSLIS
DSL
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagcaattcaccatagtcattaaacttgggacctcatcccttgtagatgaggtt
accagagaaccaagaatagccaacatgtcgcttatagtcgaaacgatggttagactacgc
cgccagggccacaaaatcgtcattgtctcgtctggggcaattgcatgtggaatgaaacaa
gttggattagaagaaaaacctgcaaatttatcagcagtgcaggctttggcttctatcgga
caagtgcgacttattagaacctttgatgatttattccggcaattagaacaaccgatagcc
cagattttactcacaagaaacgacataatggacttcactcaatacaagaacgctcaaaat
acattgaatgagttgatggatatggggatcattcctatagtcaatgaaaacgatacatta
tcagtttctgaaatcaagtttggtgataacgatagtttgtcggccatcacagccgggatc
attcatgccgattatttgtttctcatgaccgacgtcgagtgtttgtataccgacaaccca
agaaccaacccagacgcacaacctatattggtagtcgacaagattgatgatttgcatgtg
aagactgataccgagtctggtgctggatctaaagtcgggactggtgggatgaccacgaaa
ttgattgctgccgatttagcaaccaatgctggtgtgaccacgatcataacattatcgagt
caaccatattacattattgatattgttgcccatatacaggctcatgcagatacattatcg
gttgaaaaccagcgtcttgcgttacaaaaggatatccaacagggtaaaattccattgcat
acaagatttttgagcaagccccaagatacattaatcaaatctgatcgcagattctggtta
ttacatggattaaaaactaagggagcattagtcatcgaccaagggtgtttccaagcattg
acaagacgtaatcgtgcaggattattaccggttggtatacttcatgttgtggggaatttt
caccaaagtgaatgtgtatcgatcaaagttgtccctgataagaatggtgctattgatgat
gcagttgaagtgggccattgcagagtaaattacctggccccagaaatcaccctaattaaa
ggtcataaaagtagtgaaattgaagcaattctaggttatgctgatagtgaatatgtggca
catagagataatttagcattcccaccagtcatgccaccttcaacagattcgttgatctcg
gatagtttatag

DBGET integrated database retrieval system