KEGG   Candida albicans: CaO19.779Help
Entry
CaO19.779         CDS       T00189                                 

Gene name
HAT1
Definition
histone acetyltransferase
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
cal  Candida albicans
Brite
Enzymes [BR:cal01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     CaO19.779 (HAT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 413 aa AA seqDB search
MSSAKEQSSVTAALQPEQWTTSSNEALKLFVTNPEAALNFQPTFTYPIFGDAETIYGYKD
LDIFLCFDHYTFKPFLNIKYSAKLTDDPEIIDIKKTIDEFLPKSTIFKDEVKWVDSIKEE
KDNGYKIPGKLIDSFSENDKEYDIYKIDLKSDNGYELHQRLQILVLLFIEAGSFIDAKDE
LWNLYVLYEKDNKSTSNNEPSIVGFTTAYNYWKYPGAKKFDSTEQESRIKISQFIILPIY
QGQGLGQLFYSHLFDKWLAQDDIIEVVVEDPNESFDDLRDRADLKRLNTSEQFDFKAVTP
KVDKEWVEKTRRALKLEKRQFARLLEIILLYKLKHGYPGITKRDVRLFIKKRLYDKNKEG
LATLDDNTKKDKLQTAYQALEDDYYRILGDLKLNIKRENDEEETDTVSKKQKV
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgtcatccgcaaaagaacaaagtagtgttacggcagcattgcaaccagagcaatggacg
acatcatcaaatgaagcattgaaattgtttgtcaccaatcctgaagcagcacttaatttc
caacctacatttacttatccaatatttggtgatgccgaaacaatctatgggtataaagat
ttagatatatttttatgttttgatcattatacatttaaaccatttttgaatattaaatat
agtgccaaattgactgacgatccagaaattattgatatcaaaaaaaccattgatgaattc
ttacctaaactgacgattttcaaagatgaagtgaaatgggtcgattcaataaaggaagaa
aaagataatgggtataaaatacctggaaaattaatcgattcatttagtgagaatgataaa
gaatacgatatttataaaattgacttgaagtcagacaatggatatgaattacatcaacga
ttgcaaatcttagtcttattgttcattgaggcagggtcatttattgatgccaaagatgaa
ttatggaacttgtatgttttgtatgaaaaagacaataaatctacatccaataatgaacct
tctatagttgggtttaccacggcttataattattggaaatatcctggtgccaaaaaattc
gattcaactgaacaagaactgagaatcaagatatctcagtttataatattaccaatttac
caaggtcaaggcttaggacaattattttattcccatttatttgacaagtggttagcacaa
gatgatataattgaagtagtagttgaagaccctaatgaaagttttgatgatttaagggat
agagccgatttgaaaagattaaatactagtgagcaatttgatttcaaagctgttactccg
aaagtagacaaggagtgggttgaaaaaacaagacgagcattaaaattagaaaagagacag
tttgcaagattgttagaaattatattgttatacaagttgaaacatggctatcctggtatc
accaagagagacgtgaggttattcatcaaaaaaagattatatgacaagaataaggaagga
ttagccaccttagatgataacaccaagaaagataaattacagactgcttatcaagctttg
gaagatgattattatagaatattgggagacttgaagttgaacattaagcgtgagaatgat
gaagaggaaaccgacaccgtttccaaaaagcaaaaagtgtaa

DBGET integrated database retrieval system