KEGG   Candida albicans: CaO19.7828Help
Entry
CaO19.7828        CDS       T00189                                 

Gene name
ASN1
Definition
asparagine synthetase; similarity goes out and back into reading frame (compare with CaP19.1827 in same region of contig)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
cal  Candida albicans
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cal00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CaO19.7828 (ASN1)
Enzymes [BR:cal01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     CaO19.7828 (ASN1)
Peptidases [BR:cal01002]
 Cysteine Peptidases
  Family C44
   CaO19.7828 (ASN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 573 aa AA seqDB search
MCGIFAAYRQPEVEDFKSKALQYSKLIRHRGPDWSGNVVQNSTILCHERLAIVGLDSGAQ
PIVSPDGNFTLAVNGEIYNHIQLREQFPDYKFKSLSDCEPIIPLFTKYDIDAPKHLDGMF
AWVLYDKKNDRIVAARDPIGITTLYMGKSSKSPKTRYFASELKCLIEECDEIFAFPPGHV
YDSNTDEITRYFKPSWWDASKVPEQHVDFKKVRETLELAVRKRLMAEVPYGVLLSGGLDS
SLIASIASRETKKAAQASFNPEGIDANKELSGVDDKGSLHSTGVFNQLHSFAIGLPGAPD
LLAAEKVAHFIGTIHHSHTFTLEEGLDALDDVIYHLETYDVTTIRASTPMYLLSRKIKAQ
GVKMVLSGEGSDEIFGGYLYFANAPSAKEFHEECVKRVKNLHYADCLRANKSTMAWGLEA
RVPFLDKQFLEVCMNINPEDKLIQPGKIEKYILRKAFDTSDEPDVKPYLPEEILWRQKEQ
FSDGVGYSWIDGLKDTAEKMVSDEEFAHPKPEWGDDIPTTKEAYWYRCKFDKMFNGSKAA
ASTVMRWIPKAEWGCHADPSGRYAATHDHKVAQ
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggtatttttgcagcttacagacaaccagaggttgaagatttcaaaagtaaagct
ttacaatattccaaattaattagacatagaggtccagattggtcaggaaatgttgttcaa
aacagcaccatattatgtcatgaaagattggctattgttggtttagattctggtgctcaa
cctattgtttcaccagatggtaactttactttggccgttaacggggaaatctataaccat
attcaattaagagaacaatttcctgattataaattcaaatctttgagtgattgtgaacca
atcattcctcttttcacaaaatacgacattgatgccccaaaacatttagatggtatgttt
gcttgggttttatacgacaagaaaaatgatagaatagtcgctgctagagatccaatcggt
atcaccactttatacatgggtaaatcttctaaatctcctaaaacaagatattttgccagt
gaattgaaatgtttgattgaagaatgtgacgaaatttttgcatttccaccaggtcatgtt
tatgattccaacactgatgaaataacaagatacttcaaaccatcttggtgggatgcatct
aaagttccagaacaacacgttgactttaaaaaagttagagaaactttagaattggccgtg
agaaagagattaatggctgaagttccttatggtgttttattatctggtggattggattca
tctttaattgcttctattgcctctagagaaaccaaaaaagctgctcaagcttcatttaac
ccagaaggtatcgatgccaacaaggaattgtctggtgttgatgacaaaggttcattgcat
tccactggggtattcaaccaattacattcatttgctattggtttacctggtgctcctgat
ttattggctgctgaaaaagtcgctcatttcattggtaccattcatcattctcatactttc
actttagaagaaggtcttgatgccttggatgatgtcatctaccatttggaaacttatgat
gttaccaccattagagcttcaacaccaatgtacttgttatcaagaaaaatcaaagcccag
ggtgttaaaatggttctttctggtgaaggttccgatgaaatctttggtggatacttgtat
tttgccaatgctccaagtgctaaagaattccatgaagaatgtgtcaagcgagttaagaac
ttgcattatgctgattgtcttagagccaacaaatccaccatggcttggggattggaagcc
agagttccattcttggataaacaatttttggaagtttgtatgaacatcaacccagaagat
aaattgattcaaccaggtaaaattgaaaaatacattttaagaaaagcatttgataccagt
gatgaaccagatgtcaaaccttatttaccagaagaaatcctttggagacaaaaggaacaa
ttttccgacggggttggttattcatggattgatggattaaaagatactgctgaaaaaatg
gttagtgatgaagaatttgctcatccaaaaccagaatggggtgatgatattccaactact
aaagaggcttactggtacagatgtaagtttgataaaatgtttaacggttcaaaagctgct
gcatctactgttatgagatggattccaaaagctgaatggggttgtcatgccgatccatca
ggaagatacgccgctactcatgatcataaagtcgctcaatag

DBGET integrated database retrieval system