KEGG   Candida albicans: CaO19.7868Help
Entry
CaO19.7868        CDS       T00189                                 

Gene name
CCP1
Definition
Cytochrome-c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
cal  Candida albicans
Brite
Enzymes [BR:cal01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     CaO19.7868 (CCP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 366 aa AA seqDB search
MATFAPHISKITKSSTKFNYGRIAKTFLGVAGSAAIATYFYNNGNPFNNNNNNNNNNGGS
KNAAKALFGASAGANVKIAKVPEGKSASDYQKVYNDIATKISENLEFDENAGYYGQLLRL
AWHTSGTYDKSDNSGGSYGGTMIFAPEEFDPENAGLQVGREFLMEFLVKYPWISRGDLWT
LGGVAAVQESGGPKIEWRPGRVDDNTASKVPPNGRLPDASKDGKYVKDLFARMGFNERET
VALLGAHVLGRCHKHNSGYDGPWGPSFNQFTNVFYTTLLGDWHVKKWDGKKQYEDDETGE
FMMLPTDMALKEESYFLKYVKMYADDQDLFFKDFAKAFSKLISNGIKYPADSKPILFKTL
DEQDEE
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggctacatttgctccacatattagtaagattaccaaatcttcaaccaaattcaattat
ggtagaattgcaaagacatttcttggggtagctggttctgccgctattgccacttacttc
tataacaatggtaatccattcaataacaacaacaataataataacaacaatgggggttct
aaaaatgctgctaaggcattatttggagccagtgctggtgccaatgtcaaaattgctaaa
gtccctgaaggtaaaagtgctagtgattatcaaaaagtttataatgacattgctaccaag
atttctgaaaatttagaatttgatgagaatgccggttattatggtcaattgttaagattg
gcatggcatacatcaggtacttatgataaatctgataattcgggtggatcatatggtggt
acaatgatttttgctccagaagaatttgatccagaaaatgctggattacaagttggtcgt
gaatttttaatggaatttttagtgaaatatccatggatttcaagaggtgatttatggact
ttaggaggtgttgctgctgtacaagaatccggtggtccaaaaattgaatggagaccaggt
agagttgatgacaatactgcatctaaagtcccaccaaatggtagattacccgatgcttca
aaagatggtaaatatgttaaagatttgtttgctagaatgggatttaatgaaagagaaacc
gttgccttacttggtgctcatgttttaggtagatgtcataaacataattccggatatgat
ggtccatggggtccatcatttaatcaatttactaatgttttttacaccacattattaggt
gattggcacgttaaaaaatgggatggtaaaaaacaatacgaagatgatgaaactggtgaa
tttatgatgttaccaactgatatggctttgaaagaagaactgtattttttgaaatatgtc
aagatgtatgctgatgatcaagatttgtttttcaaagattttgctaaagcattttctaaa
ttgatttcaaatggtatcaaatatcctgctgatagtaaaccaatattgttcaaaacatta
gatgaacaagatgaagaataa

DBGET integrated database retrieval system