KEGG   Candida albicans: CaO19.8048Help
Entry
CaO19.8048        CDS       T00189                                 

Definition
weak similarity to CDC39, WD-40 domain
Orthology
K07204  
regulatory associated protein of mTOR
Organism
cal  Candida albicans
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
R
AA seq 1432 aa AA seqDB search
MSSSQELYTSLSRRPPQQPLNDKMRHGFDIDYNSEKFLNSLANTFYIYFDDKRQNTNGNP
LTEEMKQSAEYFKNYQPISDWKVMKERQKTINAILVLCLNLGVAPPDVIKPSPCARFESW
CDPTTFNDTKKAIENIGKNLQTQYENISSKTRYRQSLDPCVEDVKRFCNTQRRNAKDERI
LFHYNGHGVPKPTASGEIWVFNRNYTQYIPISLYDLQTWLGAPVIFVYDCNSAGNIVHNF
KKFVQKRIDDDNDGNHDQSAPSPTSAYLDCIQLAACKSNELLPMSPDLPADLFTCCLTSP
IDVSIRWFIIQSSLKKGYYDALPRNSIGNIIIPGNLNDRRTPLGELNWIFTAITDTIAWT
SLTRPIFKRLFRQDLMVAALFRNFLLAKRIMPHLNCNPISDPPLPDSVRFHPIWDSWDLA
IDQVLSRLLKSAKEETVSMPLAGNIQNGSTKGDSVSSAQQQQANGSQSAALFPNLGNVQY
TTFFEQQLTAFEIWLKFEGPSSKTPPEQLPIVLQVLLSQVHRLRALILLSQFLDLGPWAV
YLSLSIGIFPYVLRLLQSPAQELKPVLIFIWARIMAVDYKGTQQELCKDKGYNYFYSILN
SPPINHVGVNGNVATTNTGTMLINDDHKAMSAFILTLFIKDFKNGQRLCFSSEIVTNCLK
FIQTSDNPLLRQWCNLLLSQLWNRHPEGKWVIYKNNYITKLLNLIDDPIPEVRTSILVAL
TTYLSDPPHLAPQQPTNPVAVNTNDLRKDEIRQQDLKLANTVLGLLGDGSPIVRKELVFF
INKFVQTYAKFFLVVAFNQLQEEIVLIENPNYLNDFRKRSPAYGSIFSSVWKALLILSED
PHCEVKQLAETLIDYVMVQLNESELSGLVKEMQDYLLSKSTINISESFKPTKPVVNRQLG
EKRLVSSASIGNRRNTLLIDGSSLTTRSASANNITSNSNNRNIKGNMDDSDAESITSKIK
NLSVSKLFKSFHITEENDLNSFTRILNPGPVQSNYGSEYIPKTAFFKKRDLSKTPELPFE
SGFFEYSCEYFQEPQMSKNEIDEPGSKEYVKRLWRRNRNESIIQETQPQKEMALRGEWNK
DIQILNNITQPKCIKFTQFEKILVASDEKDNMTVWDWGNGQIVKKFSNGNPFGTKITDIK
FLNEDDSPLLLTGSSDGVIKIYKNFHNYENSDSNDKDEDGFNEEKRVELVTGWRALTDLL
LTSKSTGLVSEWQQSRGSLLVSGDVKIIRIWDAPRELCLSDIPARSSSSITSLTSDQVAG
DIFIAGFDDGSIRVYDTRLDSRESMVMTWKPSKQHPGLQQSNYTGLGSIRNVHMQRGGFR
ELISGSSDGIVNIWDLRLQDPVLTYATQNKSMRTMDVHEHAPILMTGLKTVDIWSTAGEC
LTTLNNPNGSSGRSLNYLSSTTFHPHRMMLATNYNQNSHINLYTCNDTVVEY
NT seq 4299 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcatcacaagaattatacacatctctttcaaggcgacctccgcaacaacctcta
aatgacaaaatgagacatgggtttgacattgattacaattctgaaaaattcttaaattca
ttagcaaacactttttacatatatttcgatgataaacgtcaaaacacaaatgggaaccca
ttgacagaagaaatgaagcagtccgctgaatactttaagaactatcaacctatatccgat
tggaaagtcatgaaagagcgacaaaagaccatcaatgcaatattagtgctatgcttaaat
ttgggtgtagcaccaccggatgtaataaaaccttcaccatgtgctagatttgagtcatgg
tgtgatccgacaacttttaatgataccaagaaagcaatagaaaatattgggaaaaacctt
cagacacaatacgaaaacatttcatcgaaaacaaggtaccgccagtcattagacccctgt
gttgaggacgtaaagaggttttgcaatactcaaagaagaaatgcgaaagatgaaaggatc
ttgtttcactataacggtcatggtgtacctaaaccaaccgctagtggagaaatatgggtc
tttaatagaaattacacccaatacattcctatatcattgtatgacttgcagacatggcta
ggtgcccccgtgatatttgtctatgactgtaatagtgctgggaatatagttcacaatttc
aaaaagtttgttcaaaagcgtatagatgatgataacgacgggaaccacgatcaaagtgca
ccttcgcccacttcggcctatcttgattgcatacagttggcagcttgtaaaagtaatgaa
ttgttacctatgagtcctgatctaccagctgatttgtttacatgctgtttaacaagtcct
atagatgtaagtataaggtggtttattattcaaagctctttgaaaaaagggtactatgac
gcattacctagaaactcaatagggaatattattattcctggtaatttaaatgataggaga
acgccattgggggaattgaattggatatttaccgctattacagatacaattgcatggacc
tctttgactagacccatctttaagcgtttattcagacaagatttgatggttgctgcattg
ttcagaaattttttattagctaaaagaatcatgccacatttgaactgtaatccaataagt
gatccaccgttgcctgattcggttaggtttcatccaatttgggattcgtgggatttagcc
atagaccaagttctttccagattattgaaaagtgccaaagaagaaacagtttcaatgcca
cttgcaggtaacattcaaaatggctccactaaaggggattctgtgtcttctgcccaacaa
caacaagccaatgggtctcaatcggcggcattatttccaaatttgggaaatgttcagtac
actacattctttgaacaacaattgacagcatttgagatttggctcaaatttgaaggtcca
tcgtcgaaaacgccgcctgaacaattaccaattgttttgcaagtattattatcacaagtg
cataggttaagagcattaattctattatctcaatttttagatcttggcccatgggcagtc
tatttatcattgtctattggtatctttccatacgttttgcgtttattgcagagtcctgca
caagaattgaagccggtgttgattttcatttgggccagaataatggcagttgattacaag
ggtactcaacaagagttatgcaaggataagggatacaattatttttactcgatcctaaat
tcgccgccaataaatcatgtgggggtgaatggtaatgtagctactactaacacaggtact
atgttgattaatgatgatcataaagcaatgagtgcatttattttgaccttgtttatcaag
gactttaaaaatgggcaaaggttgtgtttttcttcagaaattgttaccaattgtctaaaa
tttatacaaaccagtgataatccgttacttagacaatggtgtaatctattattatcgcaa
ttgtggaatagacatcctgaaggtaaatgggtgatttataaaaacaattatatcaccaaa
ttgttgaatttgattgatgatccgatacctgaggtgaggacgtcgattcttgttgcgttg
accacttatctttctgaccctcctcatttggctcctcagcaaccaactaaccctgttgct
gtcaacaccaatgatttaagaaaagatgaaattagacaacaagatttgaaattagcgaat
acagtgcttggtcttttgggtgatggctcgcctattgttcgaaaagagttggtatttttc
attaataaatttgttcaaacatatgcaaaattctttttagttgttgcatttaaccagttg
caagaagaaattgtattgattgaaaatcctaattatttgaatgatttcaggaaaaggtca
cctgcgtatgggtcaatattcagttcagtctggaaagcattattgatattgtcagaagat
ccacactgtgaggtgaagcaattggctgaaaccttgatagattatgtcatggtacagttg
aacgaaagtgagttatcaggcttggtaaaagagatgcaagattatttgttaagcaaatca
actatcaacatcagtgaaagtttcaagccaaccaaaccggttgttaataggcaattgggt
gaaaaacgattagtctcaagtgcctctattggtaatagacgaaatactttgttaatcgat
ggatcgtcactaacaacccgatcggcttctgctaacaatatcactagcaacagtaacaat
agaaacattaaaggtaatatggatgattcagatgctgagtccattacatcaaagattaaa
aatttgtccgtttcaaagcttttcaaaagtttccacattaccgaagaaaacgatttgaat
agtttcacaagaatcttgaatcctggtccagttcaatcaaattatggaagtgaatatata
ccgaaaactgcattttttaagaaaagggatttgtcaaagactcctgaattgccatttgaa
tctgggtttttcgagtatagttgtgaatattttcaggaaccgcaaatgtcgaaaaatgaa
attgatgaaccaggttctaaagagtatgtaaaacgtttatggcgaagaaatagaaatgaa
tctattattcaagaaactcaaccacaaaaggagatggctttgaggggagaatggaataaa
gatattcagatccttaacaatataacgcaaccaaaatgtataaagtttacacaatttgaa
aaaatattagttgcaagtgatgagaaagataatatgaccgtttgggattggggaaatggt
caaattgtcaaaaaattttcaaacggtaatccttttgggacaaaaattactgacataaag
tttctaaatgaagatgattcaccgttattgttgactggttcttctgatggtgtgattaag
atttataagaatttccataattatgagaacagtgattctaatgacaaagacgaagatggc
ttcaatgaagaaaaacgagttgagctagttactggatggagagcgttgactgacttattg
ttgacttcgaaaagtacgggtttggtatcagaatggcagcaatcaagaggttcgttacta
gtaagtggtgacgttaaaataattagaatatgggatgctccacgtgagttgtgtttactg
gatatcccagcgcgatcgtcgtcttcgatcacatcattgacttctgatcaagtggcgggt
gatattttcattgctggctttgatgatggtagtatccgagtttatgataccagactagat
tctcgtgaatccatggtcatgacatggaaaccaagcaaacaacaccctggtttacaacaa
tcaaactatacaggtttggggtctattagaaatgtccacatgcagcgaggtggatttagg
gagttgataagtggttcctcggacgggattgtaaacatatgggatctcagattacaagac
cccgttttgacctatgccactcaaaacaaatctatgcggactatggatgtccatgaacat
gctccaatattgatgactggtcttaaaactgtggatatatggtccacagcaggtgaatgc
ttgacaacattgaataatccaaatggatcctctggtagatcacttaattatttgtcaagt
actacattccatcctcatagaatgatgcttgcaacgaactataaccaaaatagccatatc
aatttatatacttgtaacgatacagttgttgaatattga

DBGET integrated database retrieval system