KEGG   Candida albicans: CaO19.8088Help
Entry
CaO19.8088        CDS       T00189                                 

Definition
Ubiquitin-specific protease.
Orthology
K11849  
ubiquitin carboxyl-terminal hydrolase 25/28 [EC:3.1.2.15]
Organism
cal  Candida albicans
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
R
AA seq 1304 aa AA seqDB search
MMDNEATIPSSLASTEAENVDTETGNSDKSLSHINRSSNFPETTSNQLQSNNPFRSSTST
VSVPSSESVPISQLRTRIANAELVNYPFKTLNRILDDLKWTIPVQEKYNFSMLNSKPIDY
SEELSKVVNSSVIHFETLILNNDLEYCKSVEKVEYSNSQQVLYIMRGILSDKKHGTYHFR
LAALETDSNPFVTKLIDKHQYHVIPKSSISAHDLQILLENTIDVDKIIDDAFFKSLNSPN
GQILRVTLFKAEFTQEDLVPLTDEEIIRERYLEGIKRHPNLSPETIPNQLHCIKTLIKVL
RGPVTLKPEDTIKTINLKNTVMDAQIDVNLLFEKLSFTLNGDEAVPPDLNNLPDLKESYI
RKILELIFFAKNVMVPNNEFQTLYSFSDNMSQVFHTIVEYDKNVSVRHFSSNYSNRFPYF
INLSASAYFSDELIIKCFELTVQSDSINQLYYVDSLKQIRSFRNNNGGYSVNNKLDIYFR
QRNLIGYSDFLESMKILGLAVESNETETIDDDVIIAMYRSQFKNDPKNYQYYNNHLKRIA
GIKNSEKLDDFIQKELLPIDLALEELSIEEITEDDVVITAYEFKLDELLQSNGFNGNANE
VIFLNKALLSVAVHRRSYILLEYLETKLPDYVKIPTMNEMTTRKAFETLDIDVQASESEI
ISNFQNKFLKGNVDIRLLRYALKLIAESKKSEILLSFLRTGKIDTSLLPAQNWPAGLDNI
GNTCYLNSLLQYYFCIKPLRELILTFNENNFSANDYPETRKIGGRKVENMELQRSNQFVY
QLRRLFQEMIYSNKRCVQPSKELAYLSFLPLSQPVNFKNQKKTDYSGRTTIEENKQVQLA
ETKDNQSVGTESVHGELDGVLYQQSENGLSTDKDVTMTDGDDEINTEVKDIIDMDREVET
GMEIETDVDESNKNYSMAVESPSSSRSMIEDEVETPDTSSSEDDVVGSSPKILPISSDQI
ESTIEVGRQQDVTECIENVTYQIETALPPQLIDKDGEQHDLIKQLFCGKTKQTITPLDKP
DEPPRVSLERFFSLIINVSDHPKSIYDALDYYFNEDVVKLDEGLVKKSITISELPQILQF
HVQRVLFDREKLMAYKSIEPIPFSDKIYLDRYLDTDDEEILYKRNQVFEWKREISKLQQY
KFDLLKIDPETSVSLIDSLKITEKYLENKIISDDSLSIELSTIQTINDEIRKLTSNLEDI
DNRLNELNHLISIQFQDYKSIAYNIFAVFIHRGEASYGHYWVYIKDPHNNNIFRKYNDEI
VTEVPASEIFNFLETNTATPYYIVYIKEELESSYIEPLKREIKE
NT seq 3915 nt NT seq  +upstreamnt  +downstreamnt
atgatggataatgaagcaaccataccttcatctttagcttctacagaagcggaaaatgtc
gacacagagacaggaaactcagataaatcactttcccacatcaatcgatctagcaacttt
cctgaaactacatccaatcaattacaatcaaacaacccgtttcgctcatcaaccctgaca
gtatcggtaccatcactggagtcagtgccaatttctcaactaaggactagaattgcaaat
gcagaattggtgaactatccattcaaaactttgaatagaatcttggatgatttgaaatgg
acaattccagtccaagaaaaatataatttcagcatgttaaacagtaagccaatagattat
agtgaggaattgagtaaagttgttaattcgagtgtcatacattttgaaacattgatttta
aataatgatttggagtattgcaagtcagtcgaaaaagtcgagtattccaatagtcaacaa
gtgctttatattatgagaggtattttgctggataagaagcacgggacttatcatttcaga
ttagctgcattagaaaccgactctaacccttttgtaactaaactcattgataaacatcaa
tatcatgttatccccaaatccagcatatccgcacatgatttacaaattttgttggagaat
actatagatgttgataagattattgatgatgcatttttcaagagtttaaactcaccaaat
ggtcaaatcctaagggtaacattgttcaaagcagaattcacccaagaagatttagtaccg
ttgacggacgaggagataatacgagaacggtatttagaaggaattaagagacacccaaat
ctatccccggaaacaattccaaaccaactccattgtattaaaactttgataaaagtgtta
cgaggaccggttactttgaaacccgaggacaccatcaaaacaattaacctcaaaaataca
gttatggatgcacagatcgacgtcaatttactttttgagaaattgtcatttaccttaaat
ggggatgaagcagtaccaccagacttgaacaatttgccagacttgaaggaatcgtacata
agaaaaatcttggagttgatattctttgcgaaaaatgtaatggtgccaaataacgagttc
cagactttgtattcattttccgacaatatgtctcaagtgtttcacacgatcgttgaatac
gataaaaacgtgagtgtgagacatttcagtagcaattattcaaacagatttccatatttc
atcaatcttagcgcaagtgcttatttctccgatgaattgataataaaatgtttcgagctt
acagtgcagtctgactcaatcaaccagttatactatgtggattccttaaagcaaatacga
agtttcagaaacaataatgggggttattcagtaaacaataagcttgatatttatttcaga
cagagaaatttgataggctacagtgattttcttgagtcgatgaagatattgggattagca
gttgaaagcaatgaaacagaaacaattgatgatgatgttattattgcaatgtatcggagc
caatttaaaaatgatcccaagaattaccagtattataataatcatttgaaaagaattgct
ggtatcaaaaattccgagaaacttgatgattttattcagaaagagttgctaccaatcgat
ttagcacttgaagagttgagtattgaagagattacagaggatgatgttgtgatcactgca
tacgagttcaagcttgacgagttattgcaactgaatggattcaacggcaatgctaatgaa
gtcatttttttgaataaggcattactctcagttgcagttcatcgaagaagttacatatta
ttggagtatttggaaaccaaattacctgattacgtaaaaatacccacaatgaatgaaatg
actactcgcaaggcatttgaaacacttgatattgatgtccaagctctggaatctgaaatt
atcagtaattttcaaaataaatttctcaagggaaatgtcgatattcggttgttgagatac
gcattaaaattgattgctgaatccaagaaatcagagatattattaagtttcttgagaact
ggtaaaatagatacatcattactcccagcacaaaactggcctgctgggttagataatatt
gggaacacatgctacttaaattcgttattacaatattatttttgtataaaaccattacga
gaattgattttaacatttaatgagaacaattttagtgctaatgattaccctgaaacgaga
aagataggtgggagaaaagtagaaaatatggagcttcaaagatcaaatcaattcgtttac
cagttgcgtcggttatttcaagaaatgatttatagcaacaaaagatgcgttcaacctagt
aaagaattggcatatttatcttttcttccattgtcacaaccagttaatttcaaaaatcaa
aagaagaccgattatctgggtagaactacaattgaggaaaataaacaagttcaattagct
gaaaccaaggacaaccagagtgttggcacagaatctgtgcatggcgaacttgatggagta
ttatatcaacaatcagaaaatggactcagtactgataaagatgtaactatgactgatggc
gatgatgagatcaatacagaagtaaaggatattatagacatggatagggaagttgaaact
ggaatggaaattgaaacagatgttgatgaaagcaataaaaattattccatggccgttgaa
tcacccctgtcgtcaagatctatgattgaggatgaagtagaaacccctgatacttcttca
agtgaggatgacgttgtgggatcgagtcccaaaatattacccatactgagtgatcaaatt
gaaagcacaattgaagttggtagacagcaagatgtcactgaatgtattgaaaatgtcaca
tatcaaattgagacagcattaccaccacagttgatagataaagatggcgaacaacacgat
ttaatcaaacaattattttgcggcaaaactaaacaaaccatcactcccttggataaacct
gatgagccacctagagtttctttagaaaggtttttcagtttgattattaatgttagtgat
caccccaagagtatttatgacgcgttggattattactttaatgaagatgtggttaaattg
gatgaaggattagttaaaaaaagtattaccattctggaattgccacagattttgcaattc
catgtgcaacgagttttatttgatcgtgaaaaattgatggcatataaatcaattgaacca
attccgttcagtgataagatttatttggatagatacttggataccgatgacgaagaaatc
ttatataaaagaaaccaagtgtttgagtggaaacgtgaaattctgaaattacaacaatat
aaatttgatttattgaaaatcgaccctgagacatcggtgtcattgattgatagtttgaaa
atcacggaaaaatatcttgagaacaaaattatcctggacgattctttgagtattgaattg
tctaccatacaaacgattaatgatgagatcagaaaattaacatcgaatttagaagatatt
gataatcgattgaatgaattgaatcatttaataagtatacagttccaagattataaatcg
attgcatataatatatttgccgttttcattcatcgtggtgaagcaagctatgggcattat
tgggtatacatcaaagatccacataataataatatattccggaagtataatgatgaaatt
gtcactgaagttcctgctagtgaaatattcaatttcttggaaacaaacaccgctactcct
tattatattgtttatatcaaagaagaattagaatcaagttatatagaacctttaaaaagg
gaaattaaagaataa

DBGET integrated database retrieval system