KEGG   Candida albicans: CaO19.8091Help
Entry
CaO19.8091        CDS       T00189                                 

Gene name
CEK2
Definition
Serine/threonine protein kinase of MAP kinase family; one of two genes similar to S. cerevisiae FUS3 (YBL016W) involved in pheromone signal transduction
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
cal  Candida albicans
Brite
Enzymes [BR:cal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     CaO19.8091 (CEK2)
Protein kinases [BR:cal01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   CaO19.8091 (CEK2)
Exosome [BR:cal04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CaO19.8091 (CEK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
R
AA seq 372 aa AA seqDB search
MKKSTGPTQTRQVVFNISQNFKVLKILGEGAYGIVALAVHLPTETKVAIKKIEPFERPLF
CLRTLREIKLLTKFKNHDNIVRLYDVQKPMNYDSFNEVYLIQEYMPSDLHNIIHTHLLSD
QHVQYFIYQILKGLKMIHSARVIHRDLKPSNILVNEKCDLKICDFGLARLDTKHYNFDEA
PRISMLTEYVATRWYRAPEIMLSASNYSTAIDLWSVGCILAELLTYRALFPGSDYINQLK
LIFEVLGTPTDEDLQIIKSERAQKFIRSLPTKVKIDLSEFINNHPYRNIKHRGRDQVNPL
AIDLLEKLLVFDPAKRITVQEALEHPYLNSYHEQLDEPVTSPIPIEEFDFDIDKKNLDTN
DLKKQIFEIVMS
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaatctactggccccactcaaactcgccaagtagtattcaacatatctcaaaac
tttaaagtgctcaagattttgggagagggtgcttatggcattgttgctttggcagtacat
ttacccacagagactaaggtggccatcaaaaaaatcgaaccatttgaaagaccattattc
tgtcttcgtacgttacgagaaatcaaattattaacaaaattcaagaaccacgacaatata
gttcgattatacgatgtacaaaaaccaatgaattatgacagcttcaatgaagtttatctt
attcaggaatacatgcctctggatttgcataatatcatacacacacatcttttgagcgat
caacacgttcagtattttatctatcagatcctcaaaggattaaagatgattcatagtgca
agagtaatacaccgtgatttgaaaccatccaacattttggtcaatgaaaaatgtgatttg
aagatttgtgattttggcttagctcgcttagataccaaacattacaattttgatgaagca
cctagaatttcaatgctaactgaatacgtcgctacaagatggtatcgagctccagaaatc
atgttgagtgcatccaattattcgacggctatcgatctttggtcggtgggctgtatattg
gctgaacttttgacttacagggccttgttccctggatctgactacattaatcaattgaaa
ttaatctttgaagtacttggaacaccaaccgatgaagacttgcagatcatcaaatcagaa
cgtgcacaaaagtttatcagatctctaccaacaaaggtcaagattgacttgagtgaattc
attaataatcatccatatagaaatattaaacatcgtggtcgagaccaagtgaacccatta
gccatagatttattggaaaagttattggttttcgacccagctaaaagaatcaccgttcaa
gaggcattagaacacccttatttaaattcataccacgaacaacttgatgagcctgttaca
ctgccaatacctatagaagagtttgattttgatatagataagaagaatttggacaccaat
gacttgaaaaaacaaattttcgaaatagtcatgtcgtaa

DBGET integrated database retrieval system